Recombinant Human Chorionic Gonadotropin/CGA Protein
Produktgrößen
10 ug
£145,00
RP01662-10UG
20 ug
£193,00
RP01662-20UG
50 ug
£264,00
RP01662-50UG
100 ug
£395,00
RP01662-100UG
500 ug
£1157,00
RP01662-500UG
1000 ug
£1812,00
RP01662-1000UG
Über dieses Produkt
- SKU:
- RP01662
- Zusätzliche Namen:
- CG-ALPHA|CGA|FSHA|GPA1|GPHa|GPHA1|HCG|LHA|TSHA
- Weitere Details:
- Chorionic gonadotrophin subunit alpha (CGA),a member of the glycoprotein hormones subunit alpha family, is also known as glycoprotein hormones alpha chain, choriogonadotropin alpha chain, follicle-stimulating hormone alpha chain (FSH-alpha), luteinizing hormone alpha chain (LSH-alpha) and thyroid-stimulating hormone alpha chain (TSH-alpha). The hormones human chorionic gonadotropin (hCG), luteinizing hormone (LH), follicle-stimulating hormone (FSH), and thyroid-stimulating hormone (TSH) are dimers consisting of alpha and beta subunits that are associated noncovalently. The alpha subunits (CGA) of these four human glycoprotein hormones are nearly identical, however, their beta chains are unique and confer biological specificity.
- Formulierung:
- Recombinant Human Chorionic Gonadotropin/CGA Protein is produced by HEK293 cells expression system. The target protein is expressed with sequence (Ala 25-Ser116) of human Chorionic Gonadotropin/CGA (A
- Immunogen:
- Ala 25-Ser116
- Molekulargewicht:
- 25 kDa
- Physischer Zustand:
- Lyophilized
- Reinheit:
- ≥90%
- Sequenz:
- APDVQDCPECTLQENPFFSQPGAPILQCMGCCFSRAYPTPLRSKKTMLVQKNVTSESTCCVAKSYNRVTVMGGFKVENHTACHCSTCYYHKS
- Versandbedingungen:
- Blue Ice
- Lagerbedingungen:
- -20[o]C reconstituted. Avoid freeze/thaw cycles., 2-8[o]C reconstituted., -20[o]C/-70[o]C lyophilized. Avoid freeze/thaw cycles.
- Hersteller:
- ABclonal Technology
- Typ:
- Proteins, Peptides, Small Molecules & Other Biomolecules: Peptides
- Datenblatt des Herstellers:RP01662