Recombinant Human CD9 Protein
Produktgrößen
10 ug
£163,00
RP01643-10UG
20 ug
£223,00
RP01643-20UG
50 ug
£336,00
RP01643-50UG
100 ug
£508,00
RP01643-100UG
500 ug
£1478,00
RP01643-500UG
1000 ug
£2335,00
RP01643-1000UG
Über dieses Produkt
- SKU:
- RP01643
- Zusätzliche Namen:
- BTCC-1|CD9|DRAP-27|MIC3|MRP-1|TSPAN-29|TSPAN29
- Weitere Details:
- CD9 is a member of the transmembrane 4 superfamily, which is also known as the tetraspanin family. CD9 is a cell surface glycoprotein with 4 hydrophobic domains that are described as complex with integrins and other transmembrane 4 superfamily members. It is found expressed on the surface of the exosomes. The protein takes part in cellular signal transduction events and thus play a role in the regulation of cell development and activation, growth and motility. Besides, CD9 seems to be a key role in the egg-sperm fusion during the mammalian fertilization processes. CD9 is found on the membrane of the oocytes and also appears to intervene in maintaining the normal shape of oocyte microvilli.
- Formulierung:
- Recombinant Human CD9 Protein is produced by HEK293 cells expression system. The target protein is expressed with sequence (Ser112-Ile195) of human CD9 (Accession #NP_001760.1) fused with and a 6xHis
- Immunogen:
- Ser112-Ile195
- Molekulargewicht:
- 10-15 kDa
- Physischer Zustand:
- Lyophilized
- Reinheit:
- ≥90%
- Sequenz:
- SHKDEVIKEVQEFYKDTYNKLKTKDEPQRETLKAIHYALNCCGLAGGVEQFISDICPKKDVLETFTVKSCPDAIKEVFDNKFHI
- Versandbedingungen:
- Blue Ice
- Lagerbedingungen:
- -20[o]C reconstituted. Avoid freeze/thaw cycles., 2-8[o]C reconstituted., -20[o]C/-70[o]C lyophilized. Avoid freeze/thaw cycles.
- Hersteller:
- ABclonal Technology
- Typ:
- Proteins, Peptides, Small Molecules & Other Biomolecules: Recombinant Proteins
- Datenblatt des Herstellers:RP01643