Recombinant Human CXCL10/IP-10 Protein
Produktgrößen
10 ug
£133,00
RP01638-10UG
20 ug
£181,00
RP01638-20UG
50 ug
£240,00
RP01638-50UG
100 ug
£353,00
RP01638-100UG
500 ug
£1002,00
RP01638-500UG
1000 ug
£1574,00
RP01638-1000UG
Über dieses Produkt
- SKU:
- RP01638
- Zusätzliche Namen:
- CXCL10, INP10, SCYB10, C-X-C motif chemokine 10, 10 kDa interferon gamma-induced protein, Gamma-IP10, IP-10, Small-inducible cytokine B10, Cleaved into: CXCL10(1-73)
- Weitere Details:
- C-X-C Motif Chemokine Ligand 10 (CXCL10) is a pro-inflammatory chemokine secreted by a wide spectrum of cells. It is involved in multiple mechanisms and reported to have pleiotropic effects, including immune cell migration and attraction to inflammation sites, angiogenesis, and cancer cell growth. CXCL10 is produced by pancreatic islet cells upon inflammatory stress and is specifically recognized by C-X-C Motif Chemokine Receptor 3 (CXCR3) which is expressed by activated T-lymphocytes and other immune cells.
- Formulierung:
- Recombinant Human CXCL10/IP-10 Protein is produced by E. coli expression system. The target protein is expressed with sequence (Val22-Pro98) of Human CXCL10/IP-10 Protein (Accession #NP_001556.2) fuse
- Immunogen:
- Val22-Pro98
- Molekulargewicht:
- 15 kDa
- Physischer Zustand:
- Lyophilized
- Reinheit:
- ≥95%
- Sequenz:
- VPLSRTVRCTCISISNQPVNPRSLEKLEIIPASQFCPRVEIIATMKKKGEKRCLNPESKAIKNLLKAVSKERSKRSP
- Versandbedingungen:
- Blue Ice
- Lagerbedingungen:
- -20[o]C reconstituted. Avoid freeze/thaw cycles., 2-8[o]C reconstituted., -20[o]C/-70[o]C lyophilized. Avoid freeze/thaw cycles.
- Hersteller:
- ABclonal Technology
- Typ:
- Proteins, Peptides, Small Molecules & Other Biomolecules: Recombinant Proteins
- Datenblatt des Herstellers:RP01638