Recombinant Human CD63 Protein
Produktgrößen
10 ug
£133,00
RP01627-10UG
20 ug
£181,00
RP01627-20UG
50 ug
£240,00
RP01627-50UG
100 ug
£353,00
RP01627-100UG
500 ug
£1002,00
RP01627-500UG
1000 ug
£1574,00
RP01627-1000UG
Über dieses Produkt
- SKU:
- RP01627
- Zusätzliche Namen:
- LAMP-3|ME491|MLA1|OMA81H|TSPAN30,CD63
- Weitere Details:
- The cluster of differentiation (CD) system is commonly used as cell markers in Immunophenotyping. Different kinds of cells in the immune system can be identified through the surface CD molecules which associating with the immune function of the cell. There are more than 320 CD unique clusters and subclusters have been identified. Some of the CD molecules serve as receptors or ligands important to the cell through initiating a signal cascade which then alter the behavior of the cell. Some CD proteins do not take part in cell signal process but have other functions such as cell adhesion. Cluster of differentiation 63 (CD63) is a member of the CD family and the transmembrane 4 superfamily, also known as the tetraspanin family. CD63 is a cell surface glycoprotein characterized by the presence of four hydrophobic domains. CD63 had functions in mediating signal transduction processes and then regulate a variety of cellular processes such as cell proliferation, activation and motility. It has been reported that CD63 protein associated with tumor progression and served as a blood platelet activation marker and the deficiency of this protein may be associated with Hermansky-Pudlak syndrome.
- Formulierung:
- Recombinant Human CD63 Protein is produced by HEK293 cells expression system. The target protein is expressed with sequence (Ala103-Val203) of human CD63 (Accession #NP_001771.1) fused with a 6xHis ta
- Immunogen:
- Ala103-Val203
- Molekulargewicht:
- 20-30 kDa
- Physischer Zustand:
- Lyophilized
- Reinheit:
- ≥95%
- Sequenz:
- AGYVFRDKVMSEFNNNFRQQMENYPKNNHTASILDRMQADFKCCGAANYTDWEKIPSMSKNRVPDSCCINVTVGCGINFNEKAIHKEGCVEKIGGWLRKNV
- Versandbedingungen:
- Blue Ice
- Lagerbedingungen:
- -20[o]C reconstituted. Avoid freeze/thaw cycles., 2-8[o]C reconstituted., -20[o]C/-70[o]C lyophilized. Avoid freeze/thaw cycles.
- Hersteller:
- ABclonal Technology
- Typ:
- Proteins, Peptides, Small Molecules & Other Biomolecules: Recombinant Proteins
- Datenblatt des Herstellers:RP01627