Recombinant Mouse CCL2/MCP-1 Protein
Produktgrößen
20 ug
£193,00
RP01626-20UG
50 ug
£288,00
RP01626-50UG
100 ug
£431,00
RP01626-100UG
500 ug
£1240,00
RP01626-500UG
1000 ug
£1954,00
RP01626-1000UG
Über dieses Produkt
- SKU:
- RP01626
- Zusätzliche Namen:
- C-C motif chemokine ligand 2, CCL2, GDCF-2, HC11, HSMCR30, MCAF, Mcp1, MCP-1, SCYA2, SMC-CF,CCL2
- Weitere Details:
- Monocyte chemoattractant protein 1 (MCP-1), also called CCL2, belongs to a group of CC chemokines located in chromosome 17q11.2. MCP-1 protein interacts with chemokine C-C motif receptor 2 (CCR2) to activate and recruit monocytes, macrophages, CD4+ T cells and immature dendritic cells to the site of infection. The presence of MCP-1 protein in an adequate concentration is important for granuloma formation and M. tuberculosis clearance.
- Formulierung:
- Recombinant Mouse CCL2/MCP-1 Protein is produced by Pichia expression system. The target protein is expressed with sequence (Gln 24-Asn148) of mouse CCL2/MCP-1 (Accession #NP_035463.1) fused with no a
- Immunogen:
- Gln 24-Asn148
- Molekulargewicht:
- 14-18 kDa
- Physischer Zustand:
- Lyophilized
- Reinheit:
- ≥95%
- Sequenz:
- QPDAVNAPLTCCYSFTSKMIPMSRLESYKRITSSRCPKEAVVFVTKLKREVCADPKKEWVQTYIKNLDRNQMRSEPTTLFKTASALRSSAPLNVKLTRKSEANASTTFSTTTSSTSVGVTSVTVN
- Versandbedingungen:
- Blue Ice
- Lagerbedingungen:
- -20[o]C reconstituted. Avoid freeze/thaw cycles., 2-8[o]C reconstituted., -20[o]C/-70[o]C lyophilized. Avoid freeze/thaw cycles.
- Hersteller:
- ABclonal Technology
- Typ:
- Proteins, Peptides, Small Molecules & Other Biomolecules: Recombinant Proteins
- Datenblatt des Herstellers:RP01626
