Recombinant Human CCL13/MCP-4 Protein
Produktgrößen
10 ug
£133,00
RP01614-10UG
20 ug
£181,00
RP01614-20UG
50 ug
£240,00
RP01614-50UG
100 ug
£353,00
RP01614-100UG
500 ug
£1002,00
RP01614-500UG
1000 ug
£1574,00
RP01614-1000UG
Über dieses Produkt
- SKU:
- RP01614
- Zusätzliche Namen:
- CCL13,CKb10,MCP-4,NCC-1,NCC1,SCYA13,SCYL1
- Weitere Details:
- Monocyte Chemoattractant Proteins 4 (MCP-4/CCL13) is a member of a distinct, structurally-related subclass of CC chemokines mainly involved in recruitment of eosinphils to inflammatory sites. CCL13/MCP-4, is a CC family chemokine that is chemoattractant for eosinophils, basophils, monocytes, macrophages, immature dendritic cells, and T cells, and its capable of inducing crucial immuno-modulatory responses through its effects on epithelial, muscular and endothelial cells. Similar to other CC chemokines, CCL13 binds to several chemokine receptors (CCR1, CCR2 and CCR3), allowing it to elicit different effects on its target cells. A number of studies have shown that CCL13 is involved in many chronic inflammatory diseases, in which it functions as a pivotal molecule involved in the selective recruitment of cell lineages to the inflamed tissues and their subsequent activation. MCP-4/CCL13 is secreted from chondrocytes and activates the proliferation of rheumatoid synovial cells, thereby leading to joint destruction in RA.
- Formulierung:
- Recombinant Human CCL13/MCP-4 Protein is produced by Pichia expression system. The target protein is expressed with sequence (Gln24-Thr98) of human CCL13/MCP-4 (Accession #NP_005399.1) fused with no a
- Immunogen:
- Gln24-Thr98
- Molekulargewicht:
- 10-15 kDa
- Physischer Zustand:
- Lyophilized
- Reinheit:
- ≥95%
- Sequenz:
- QPDALNVPSTCCFTFSSKKISLQRLKSYVITTSRCPQKAVIFRTKLGKEICADPKEKWVQNYMKHLGRKAHTLKT
- Versandbedingungen:
- Blue Ice
- Lagerbedingungen:
- -20[o]C reconstituted. Avoid freeze/thaw cycles., 2-8[o]C reconstituted., -20[o]C/-70[o]C lyophilized. Avoid freeze/thaw cycles.
- Hersteller:
- ABclonal Technology
- Typ:
- Proteins, Peptides, Small Molecules & Other Biomolecules: Recombinant Proteins
- Datenblatt des Herstellers:RP01614