Recombinant Human CCL1/I-309 Protein
Produktgrößen
10 ug
£133,00
RP01613-10UG
20 ug
£181,00
RP01613-20UG
50 ug
£240,00
RP01613-50UG
500 ug
£1002,00
RP01613-500UG
1000 ug
£1574,00
RP01613-1000UG
Über dieses Produkt
- SKU:
- RP01613
- Zusätzliche Namen:
- CCL1,I-309,P500,SCYA1,SISe,TCA3
- Weitere Details:
- CCL1 or chemokine (C-C motif) ligand 1, also known as I-309 or TCA-3, is a member of the chemokine (C-C motif) ligand family. The C-C chemokines have two cysteines nearby the amino terminus. There have been at least 27 distinct members of this subgroup reported for mammals, called C-C chemokine ligands (CCL)-1 to 28. I-309/CCL1/TCA-3 interacts with the G protein-linked transmembrane chemokine receptors CCR8 and induces biochemical events that may result in the control of chemotaxis, proliferation, apoptosis and adhesion. It has been demonstrated that I-309/CCL1/TCA-3 displays chemotactic activity for monocytes and other cell types such as NK cells and dendritic cells, but not for neutrophils. Furthermore, as the only known physiological ligand for CCR8, I-309/CCL1/TCA-3 was identified as a potent inhibitor of HIV-1 envelope-mediated cell-cell fusion and virus infection. I-309/CCL1/TCA-3 induces significant levels of LTC4 from elicited eosinophils.
- Formulierung:
- Recombinant Human CCL1/I-309 Protein is produced by Pichia expression system. The target protein is expressed with sequence (Lys24-Lys96) of human CCL1/I-309 (Accession #NP_002972.1) fused with no add
- Immunogen:
- Lys24-Lys96
- Molekulargewicht:
- 10-25 kDa
- Physischer Zustand:
- Lyophilized
- Reinheit:
- ≥95%
- Sequenz:
- KSMQVPFSRCCFSFAEQEIPLRAILCYRNTSSICSNEGLIFKLKRGKEACALDTVGWVQRHRKMLRHCPSKRK
- Versandbedingungen:
- Blue Ice
- Lagerbedingungen:
- -20[o]C reconstituted. Avoid freeze/thaw cycles., 2-8[o]C reconstituted., -20[o]C/-70[o]C lyophilized. Avoid freeze/thaw cycles.
- Hersteller:
- ABclonal Technology
- Typ:
- Proteins, Peptides, Small Molecules & Other Biomolecules: Recombinant Proteins
- Datenblatt des Herstellers:RP01613