Recombinant Human CCL5/RANTES Protein
Produktgrößen
10 ug
£145,00
RP01611LQ-10UG
20 ug
£193,00
RP01611LQ-20UG
50 ug
£288,00
RP01611LQ-50UG
100 ug
£431,00
RP01611LQ-100UG
500 ug
£1539,00
RP01611LQ-500UG
1000 ug
£2420,00
RP01611LQ-1000UG
Über dieses Produkt
- SKU:
- RP01611LQ
- Zusätzliche Namen:
- D17S136E|eoCP|RANTES|SCYA5|SIS-delta|SISd|TCP228,CCL5
- Weitere Details:
- Chemokines form a superfamily of secreted proteins involved in immunoregulatory and inflammatory processes. The superfamily is divided into four subfamilies based on the arrangement of the N-terminal cysteine residues of the mature peptide. This chemokine, a member of the CC subfamily, functions as a chemoattractant for blood monocytes, memory T helper cells and eosinophils. It causes the release of histamine from basophils and activates eosinophils. This cytokine is one of the major HIV-suppressive factors produced by CD8+ cells. It functions as one of the natural ligands for the chemokine receptor chemokine (C-C motif) receptor 5 (CCR5), and it suppresses in vitro replication of the R5 strains of HIV-1, which use CCR5 as a coreceptor. Alternative splicing results in multiple transcript variants that encode different isoforms.
- Formulierung:
- Recombinant Human CCL5/RANTES Protein is produced by Pichia expression system. The target protein is expressed with sequence (Ser24-Ser91) of human CCL5/RANTES (Accession #NP_002976.2) fused with a 6x
- Immunogen:
- Ser24-Ser91
- Molekulargewicht:
- 10-15 kDa
- Reinheit:
- ≥95%
- Sequenz:
- SPYSSDTTPCCFAYIARPLPRAHIKEYFYTSGKCSNPAVVFVTRKNRQVCANPEKKWVREYINSLEMS
- Versandbedingungen:
- Dry Ice
- Lagerbedingungen:
- -70[o]C Aliquot. Avoid freeze/thaw cycles.
- Hersteller:
- ABclonal Technology
- Typ:
- Proteins, Peptides, Small Molecules & Other Biomolecules: Recombinant Proteins
- Datenblatt des Herstellers:RP01611LQ