Recombinant Human CXCL7/PPBP Protein
Produktgrößen
10 ug
£145,00
RP01599-10UG
20 ug
£193,00
RP01599-20UG
50 ug
£288,00
RP01599-50UG
500 ug
£1240,00
RP01599-500UG
1000 ug
£1954,00
RP01599-1000UG
Über dieses Produkt
- SKU:
- RP01599
- Zusätzliche Namen:
- PPBP,B-TG1,Beta-TG,CTAP-III,CTAP3,CTAPIII,CXCL7,LA-PF4,LDGF,MDGF,NAP-2,PBP,SCYB7,TC1,TC2,TGB,TGB1,THBGB,THBGB1
- Weitere Details:
- This protein is a platelet-derived growth factor that belongs to the CXC chemokine family. This growth factor is a potent chemoattractant and activator of neutrophils. It has been shown to stimulate various cellular processes including DNA synthesis, mitosis, glycolysis, intracellular cAMP accumulation, prostaglandin E2 secretion, and synthesis of hyaluronic acid and sulfated glycosaminoglycan. It also stimulates the formation and secretion of plasminogen activator by synovial cells. The protein also is an antimicrobial protein with bactericidal and antifungal activity.
- Formulierung:
- Recombinant Human CXCL7/PPBP Protein is produced by E. coli expression system. The target protein is expressed with sequence (Ala59-Asp128) of human CXCL7/PPBP (Accession #NP_002695.1) fused with no a
- Immunogen:
- Ala59-Asp128
- Molekulargewicht:
- 10-15 kDa
- Physischer Zustand:
- Lyophilized
- Reinheit:
- ≥95%
- Sequenz:
- AELRCMCIKTTSGIHPKNIQSLEVIGKGTHCNQVEVIATLKDGRKICLDPDAPRIKKIVQKKLAGDESAD
- Versandbedingungen:
- Blue Ice
- Lagerbedingungen:
- -20[o]C reconstituted. Avoid freeze/thaw cycles., 2-8[o]C reconstituted., -20[o]C/-70[o]C lyophilized. Avoid freeze/thaw cycles.
- Hersteller:
- ABclonal Technology
- Typ:
- Proteins, Peptides, Small Molecules & Other Biomolecules: Recombinant Proteins
- Datenblatt des Herstellers:RP01599