Recombinant Mouse IL-13 Protein
Produktgrößen
10 ug
£163,00
RP01596-10UG
20 ug
£223,00
RP01596-20UG
50 ug
£336,00
RP01596-50UG
100 ug
£508,00
RP01596-100UG
500 ug
£1478,00
RP01596-500UG
1000 ug
£2335,00
RP01596-1000UG
Über dieses Produkt
- SKU:
- RP01596
- Zusätzliche Namen:
- Interleukin-13, IL-13, T-Cell Activation Protein P600, Il13, Il-13,IL13,Interleukin-13, IL-13, T-Cell Activation Protein P600, Il13, Il-13,IL13
- Weitere Details:
- Mouse interleukin 13 (mIL-13) is a pleiotropic cytokine produced by activated Th2 cells. IL-13 induces B cell proliferation and immunoglobin production. It contains a four helical bundle with two internal disulfide bonds. Mouse IL13 shares 58% sequence identity with human protein and exhibits cross-species activity. IL13 signals via receptor IL13R (type2, IL4R) and activates STAT-6. IL13 initially binds IL-13RA Alpha1 with low affinity and triggers association of IL4R A Alpha , generating a high affinity heterodimeric receptor IL13R and eliciting downstream signals. IL13 also binds IL-13RA Alpha2 with high affinity, which plays a role in a negative feedback system of IL13 signaling. IL13 is an important mediator of allergic inflammation and disease.
- Formulierung:
- Recombinant Mouse IL-13 Protein is produced by HEK293 cells expression system. The target protein is expressed with sequence (Ser26-Phe131) of mouse IL-13 (Accession #NP_032381.1) fused with and a 6xH
- Immunogen:
- Ser26-Phe131
- Molekulargewicht:
- 15-35 kDa
- Physischer Zustand:
- Lyophilized
- Reinheit:
- ≥95%
- Sequenz:
- SVSLPLTLKELIEELSNITQDQTPLCNGSMVWSVDLAAGGFCVALDSLTNISNCNAIYRTQRILHGLCNRKAPTTVSSLPDTKIEVAHFITKLLSYTKQLFRHGPF
- Versandbedingungen:
- Blue Ice
- Lagerbedingungen:
- -20[o]C reconstituted. Avoid freeze/thaw cycles., 2-8[o]C reconstituted., -20[o]C/-70[o]C lyophilized. Avoid freeze/thaw cycles.
- Hersteller:
- ABclonal Technology
- Typ:
- Proteins, Peptides, Small Molecules & Other Biomolecules: Recombinant Proteins
- Datenblatt des Herstellers:RP01596
