Recombinant Human CCL16/HCC-4 Protein
Produktgrößen
10 ug
£145,00
RP01595-10UG
20 ug
£193,00
RP01595-20UG
500 ug
£1240,00
RP01595-500UG
1000 ug
£1954,00
RP01595-1000UG
Über dieses Produkt
- SKU:
- RP01595
- Zusätzliche Namen:
- CCL16, ILINCK, NCC4, SCYA16,C-C motif chemokine 16
- Weitere Details:
- CCL16/HCC-4 Shows chemotactic activity for lymphocytes and monocytes but not neutrophils. Also shows potent myelosuppressive activity, suppresses proliferation of myeloid progenitor cells. Recombinant SCYA16 shows chemotactic activity for monocytes and THP-1 monocytes, but not for resting lymphocytes and neutrophils. Induces a calcium flux in THP-1 cells that were desensitized by prior expression to RANTES.
- Formulierung:
- Recombinant Human CCL16/HCC-4 Protein is produced by HEK293 cells expression system. The target protein is expressed with sequence (Gln24-Gln120) of Human CCL16/HCC-4 (Accession # O15467) fused with w
- Immunogen:
- Gln24-Gln120
- Molekulargewicht:
- 11.20 kDa
- Physischer Zustand:
- Lyophilized
- Reinheit:
- ≥95%
- Sequenz:
- QPKVPEWVNTPSTCCLKYYEKVLPRRLVVGYRKALNCHLPAIIFVTKRNREVCTNPNDDWVQEYIKDPNLPLLPTRNLSTVKIITAKNGQPQLLNSQ
- Versandbedingungen:
- Blue Ice
- Lagerbedingungen:
- -20[o]C reconstituted. Avoid freeze/thaw cycles., 2-8[o]C reconstituted., -20[o]C/-70[o]C lyophilized. Avoid freeze/thaw cycles.
- Hersteller:
- ABclonal Technology
- Typ:
- Proteins, Peptides, Small Molecules & Other Biomolecules: Recombinant Proteins
- Datenblatt des Herstellers:RP01595