Recombinant Mouse Asparaginyl endopeptidase/Legumain/LGMN Protein
Produktgrößen
10 ug
£145,00
RP01579-10UG
20 ug
£193,00
RP01579-20UG
50 ug
£288,00
RP01579-50UG
100 ug
£431,00
RP01579-100UG
500 ug
£1240,00
RP01579-500UG
1000 ug
£1954,00
RP01579-1000UG
Über dieses Produkt
- SKU:
- RP01579
- Zusätzliche Namen:
- AEP, Prsc1,LGMN
- Weitere Details:
- The Mammalian Legumain, also known as LGMN, also called asparaginyl endopeptidase (AEP), is a cysteine protease belonging to peptidase family C13 with strict specificity for hydrolysis of asparaginyl bonds. Has a strict specificity for hydrolysis of asparaginyl bonds. Can also cleave aspartyl bonds slowly, especially under acidic conditions. May be involved in the processing of proteins for MHC class II antigen presentation in the lysosomal/endosomal system. Required for normal lysosomal protein degradation in renal proximal tubules. Required for normal degradation of internalized EGFR. Plays a role in the regulation of cell proliferation via its role in EGFR degradation.
- Formulierung:
- Recombinant Mouse Asparaginyl endopeptidase/Legumain/LGMN Protein is produced by HEK293 cells expression system. The target protein is expressed with sequence (Val18-Tyr435) of mouse Asparaginyl endop
- Immunogen:
- Val18-Tyr435
- Molekulargewicht:
- 60 kda
- Physischer Zustand:
- Lyophilized
- Reinheit:
- ≥95%
- Sequenz:
- VPVGVDDPEDGGKHWVVIVAGSNGWYNYRHQADACHAYQIIHRNGIPDEQIIVMMYDDIANSEENPTPGVVINRPNGTDVYKGVLKDYTGEDVTPENFLAVLRGDAEAVKGKGSGKVLKSGPRDHVFIYFTDHGATGILVFPNDDLHVKDLNKTIRYMYEHKMYQKMVFYIEACESGSMMNHLPDDINVYATTAANPKESSYACYYDEERGTYLGDWYSVNWMEDSDVEDLTKETLHKQYHLVKSHTNTSHVMQYGNKSISTMKVMQFQGMKHRASSPISLPPVTHLDLTPSPDVPLTILKRKLLRTNDVKESQNLIGQIQQFLDARHVIEKSVHKIVSLLAGFGETAERHLSERTMLTAHDCYQEAVTHFRTHCFNWHSVTYEHALRYLYVLANLCEAPYPIDRIEMAMDKVCLSHY
- Versandbedingungen:
- Blue Ice
- Lagerbedingungen:
- -20[o]C reconstituted. Avoid freeze/thaw cycles., 2-8[o]C reconstituted., -20[o]C/-70[o]C lyophilized. Avoid freeze/thaw cycles.
- Hersteller:
- ABclonal Technology
- Typ:
- Proteins, Peptides, Small Molecules & Other Biomolecules: Enzymes
- Datenblatt des Herstellers:RP01579