Recombinant Mouse Ep-CAM/TROP-1/CD326 Protein
Produktgrößen
10 ug
£127,00
RP01570-10UG
20 ug
£157,00
RP01570-20UG
50 ug
£223,00
RP01570-50UG
100 ug
£336,00
RP01570-100UG
500 ug
£907,00
RP01570-500UG
1000 ug
£1478,00
RP01570-1000UG
Über dieses Produkt
- SKU:
- RP01570
- Zusätzliche Namen:
- 17-1A, 323/A3, ACSTD1,CD326,EGP-2, EGP314, EGP40, EpCAM, MOC31, TACST-1, TACSTD1,TROP1,EpCAM
- Weitere Details:
- Epithelial Cellular Adhesion Molecule (Ep-CAM), also known as EGP314, mEGP314, Protein 289A, Tumor-associated calcium signal transducer 1, CD326, belongs to the EPCAM family. Its ' monomer subunit structureinteracts with phosphorylated CLDN7. Ep-CAM may act as a physical homophilic interaction molecule betweenintestinal epithelial cells (IECs) and intraepithelial lymphocytes (IELs) at the mucosal epithelium for providingimmunological barrier as a first line of defense against mucosal infection. It plays a role in embryonic stem cellsproliferation and differentiation. It also up-regulates the expression of FABP5, MYC and cyclins A and E. Thepost-translational modification glycosylation at Asn-198 is crucial for protein stability.
- Formulierung:
- Recombinant Mouse Ep-CAM/TROP-1/CD326 Protein is produced by HEK293 cells expression system. The target protein is expressed with sequence (Gln24-Thr266) of mouse Ep-CAM/TROP-1/CD326 (Accession #NP_03
- Immunogen:
- Gln24-Thr266
- Molekulargewicht:
- 35-40 kDa
- Physischer Zustand:
- Lyophilized
- Reinheit:
- ≥95%
- Sequenz:
- QRDCVCDNYKLATSCSLNEYGECQCTSYGTQNTVICSKLASKCLAMKAEMTHSKSGRRIKPEGAIQNNDGLYDPDCDEQGLFKAKQCNGTATCWCVNTAGVRRTDKDTEITCSERVRTYWIIIELKHKERESPYDHQSLQTALQEAFTSRYKLNQKFIKNIMYENNVITIDLMQNSSQKTQDDVDIADVAYYFEKDVKGESLFHSSKSMDLRVNGEPLDLDPGQTLIYYVDEKAPEFSMQGLT
- Versandbedingungen:
- Blue Ice
- Lagerbedingungen:
- -20[o]C reconstituted. Avoid freeze/thaw cycles., 2-8[o]C reconstituted., -20[o]C/-70[o]C lyophilized. Avoid freeze/thaw cycles.
- Hersteller:
- ABclonal Technology
- Typ:
- Proteins, Peptides, Small Molecules & Other Biomolecules: Recombinant Proteins
- Datenblatt des Herstellers:RP01570