Recombinant Mouse TREM2 Protein
Produktgrößen
10 ug
£133,00
RP01558-10UG
20 ug
£181,00
RP01558-20UG
50 ug
£240,00
RP01558-50UG
100 ug
£353,00
RP01558-100UG
500 ug
£1002,00
RP01558-500UG
1000 ug
£1574,00
RP01558-1000UG
Über dieses Produkt
- SKU:
- RP01558
- Zusätzliche Namen:
- TREM-2,Trem2a,Trem2b,Trem2c,TREM2
- Weitere Details:
- Triggering Receptor Expressed on Myeloid cells 2 (TREM2)is a 35 kDa type I transmembrane member of the TREM family and Ig superfamily. Mature human TREM2 consists of a 156 amino acid (aa) extracellular domain (ECD) with one V-type Ig-like domain, a 21 aa transmembrane (TM) domain, and a 35 aa cytoplasmic tail. Soluble forms of the TREM2 ECD are generated by alternative splicing or proteolytic cleavage, and the cytoplasmic domain can be liberated by gamma-Secretase mediated intramembrane cleavage. A positively charged lysine within the transmembrane segment allows association with the signal adapter protein, DAP12 and inhibition of macrophage activation. TREM2 is expressed on macrophages, immature myeloid dendritic cells, osteoclasts, microglia, and adipocytes.It promotes the differentiation and function of osteoclasts, the production of inflammatory cytokines by adipocytes, insulin resistance, and the phagocytic clearance of bacteria
- Formulierung:
- Recombinant Mouse TREM2 Protein is produced by HEK293 cells expression system. The target protein is expressed with sequence (Leu19-Ser171) of mouse TREM-2 (Accession #NP_112544.1) fused with a 6xHis
- Immunogen:
- Leu19-Ser171
- Molekulargewicht:
- 25-40 kDa
- Physischer Zustand:
- Lyophilized
- Reinheit:
- ≥90%
- Sequenz:
- LNTTVLQGMAGQSLRVSCTYDALKHWGRRKAWCRQLGEEGPCQRVVSTHGVWLLAFLKKRNGSTVIADDTLAGTVTITLKNLQAGDAGLYQCQSLRGREAEVLQKVLVEVLEDPLDDQDAGDLWVPEESSSFEGAQVEHSTSRNQETSFPPTS
- Versandbedingungen:
- Blue Ice
- Lagerbedingungen:
- -20[o]C reconstituted. Avoid freeze/thaw cycles., 2-8[o]C reconstituted., -20[o]C/-70[o]C lyophilized. Avoid freeze/thaw cycles.
- Hersteller:
- ABclonal Technology
- Typ:
- Proteins, Peptides, Small Molecules & Other Biomolecules: Recombinant Proteins
- Datenblatt des Herstellers:RP01558
