Recombinant Mouse CD83 Protein
Produktgrößen
10 ug
£127,00
RP01555-10UG
20 ug
£175,00
RP01555-20UG
50 ug
£240,00
RP01555-50UG
100 ug
£336,00
RP01555-100UG
500 ug
£1002,00
RP01555-500UG
1000 ug
£1574,00
RP01555-1000UG
Über dieses Produkt
- SKU:
- RP01555
- Zusätzliche Namen:
- BL11,HB15,CD83
- Weitere Details:
- Mouse CD83 is a 30-35 kDa member of the Siglec (or sialic-acid-binding immunoglobulin-like lectin) family of transmembrane proteins.CD83 is considered as a marker of mature dendritic cells as well as an adhesion receptor that binds to resting monocytes and a subset of activated CD8+ T cells. In certain conditions, CD83 tended to dimerize or even multimerize through its aberrant intermolecular disulfide bonds. The injection of CD83-Ig can significantly enhaunce the rate of tumor growth and inhibit the T cell growth.
- Formulierung:
- Recombinant Mouse CD83 Protein is produced by HEK293 cells expression system. The target protein is expressed with sequence (Met22-Ala134) of mouse CD83 (Accession #NP_033986.1) fused with a 6xHis tag
- Immunogen:
- Met22-Ala134
- Molekulargewicht:
- 25-35 kDa
- Physischer Zustand:
- Lyophilized
- Reinheit:
- ≥95%
- Sequenz:
- MREVTVACSETADLPCTAPWDPQLSYAVSWAKVSESGTESVELPESKQNSSFEAPRRRAYSLTIQNTTICSSGTYRCALQELGGQRNLSGTVVLKVTGCPKEATESTFRKYRA
- Versandbedingungen:
- Blue Ice
- Lagerbedingungen:
- -20[o]C reconstituted. Avoid freeze/thaw cycles., 2-8[o]C reconstituted., -20[o]C/-70[o]C lyophilized. Avoid freeze/thaw cycles.
- Hersteller:
- ABclonal Technology
- Typ:
- Proteins, Peptides, Small Molecules & Other Biomolecules: Recombinant Proteins
- Datenblatt des Herstellers:RP01555