Recombinant Mouse TNFRSF9/4-1BB/CD137 Protein
Produktgrößen
10 ug
£133,00
RP01552-10UG
20 ug
£181,00
RP01552-20UG
50 ug
£240,00
RP01552-50UG
100 ug
£353,00
RP01552-100UG
500 ug
£1002,00
RP01552-500UG
1000 ug
£1574,00
RP01552-1000UG
Über dieses Produkt
- SKU:
- RP01552
- Zusätzliche Namen:
- 4-1BB ,CD137 ,CDw137 ,ILA,TNFRSF9,4-1BB ,CD137 ,CDw137 ,ILA,TNFRSF9
- Weitere Details:
- CD137 (also known as 4-1BB) is a surface co-stimulatory glycoprotein originally described as present on activated T lymphocytes, which belongs to the tumor necrosis factor (TNF) receptor superfamily. It is expressed mainly on activated CD4+ and CD8+ T cells, and binds to a high-affinity ligand (4-1BBL) expressed on several antigen-presenting cells such as macrophages and activated B cells. Upon ligand binding, 4-1BB is associated with the tumor necrosis factor receptor-associated factors (TRAFs), the adaptor protein which mediates downstream signaling events including the activation of NF-kappaB and cytokine production. 4-1BB signaling either by binding to 4-1BBL or by antibody ligation delivers signals for T-cell activation and growth, as well as monocyte proliferation and B-cell survival, and plays an important role in the amplification of T cell-mediated immune responses.
- Formulierung:
- Recombinant Mouse TNFRSF9/4-1BB/CD137 Protein is produced by HEK293 cells expression system. The target protein is expressed with sequence (Val24-Leu211) of mouse TNFRSF9/4-1BB/CD137 (Accession #NP_00
- Immunogen:
- Val24-Leu211
- Molekulargewicht:
- 45-55 kDa
- Physischer Zustand:
- Lyophilized
- Reinheit:
- ≥95%
- Sequenz:
- VQNSCDNCQPGTFCRKYNPVCKSCPPSTFSSIGGQPNCNICRVCAGYFRFKKFCSSTHNAECECIEGFHCLGPQCTRCEKDCRPGQELTKQGCKTCSLGTFNDQNGTGVCRPWTNCSLDGRSVLKTGTTEKDVVCGPPVVSFSPSTTISVTPEGGPAFKKTTGAAQEEDACSCRCPQEEEGGGGGYEL
- Versandbedingungen:
- Blue Ice
- Lagerbedingungen:
- -20[o]C reconstituted. Avoid freeze/thaw cycles., 2-8[o]C reconstituted., -20[o]C/-70[o]C lyophilized. Avoid freeze/thaw cycles.
- Hersteller:
- ABclonal Technology
- Typ:
- Proteins, Peptides, Small Molecules & Other Biomolecules: Recombinant Proteins
- Datenblatt des Herstellers:RP01552