Recombinant Mouse HMGB1 Protein
Produktgrößen
10 ug
£163,00
RP01545-10UG
20 ug
£223,00
RP01545-20UG
50 ug
£336,00
RP01545-50UG
100 ug
£508,00
RP01545-100UG
500 ug
£1478,00
RP01545-500UG
1000 ug
£2335,00
RP01545-1000UG
Über dieses Produkt
- SKU:
- RP01545
- Zusätzliche Namen:
- HMG-1,HMG1,HMG3,SBP-1,HMGB1
- Weitere Details:
- High-mobility group box 1 protein (HMGB1), also known as HMG-1 or amphoterin previously, is a member of the HMGB family consisting of three members, HMGB1, HMGB2 and HMGB3. Posttranslational modification of HMGB1, including acetylation, phosphorylation, and methylation, affects HMGB1 localization, receptor interactions, and bioactivity. HMGB1 can be localized to the nucleus or cytoplasm and can also be secreted despite its lack of a signal peptide. HMGB1 binds DNA in a non-sequence specific manner and may act as a structural cofactor during gene transcription.Acetylation of HMGB1 results in its cytoplasmic localization and eventual secretion. HMGB1 can be secreted by multiple cell types, and it is also released upon cell necrosis, apoptosis, and pyroptosis.
- Formulierung:
- Recombinant Mouse HMGB1 Protein is produced by HEK293 cells expression system. The target protein is expressed with sequence (Met1-Glu215) of mouse HMGB1 (Accession #NP_001300823.1) fused with a 6xHis
- Immunogen:
- Met1-Glu215
- Molekulargewicht:
- 30-40 kDa
- Physischer Zustand:
- Lyophilized
- Reinheit:
- ≥95%
- Sequenz:
- MGKGDPKKPRGKMSSYAFFVQTCREEHKKKHPDASVNFSEFSKKCSERWKTMSAKEKGKFEDMAKADKARYEREMKTYIPPKGETKKKFKDPNAPKRPPSAFFLFCSEYRPKIKGEHPGLSIGDVAKKLGEMWNNTAADDKQPYEKKAAKLKEKYEKDIAAYRAKGKPDAAKKGVVKAEKSKKKKEEEDDEEDEEDEEEEEEEEDEDEEEDDDDE
- Versandbedingungen:
- Blue Ice
- Lagerbedingungen:
- -20[o]C reconstituted. Avoid freeze/thaw cycles., 2-8[o]C reconstituted., -20[o]C/-70[o]C lyophilized. Avoid freeze/thaw cycles.
- Hersteller:
- ABclonal Technology
- Typ:
- Proteins, Peptides, Small Molecules & Other Biomolecules: Recombinant Proteins
- Datenblatt des Herstellers:RP01545