Recombinant Mouse Prolactin/PRL Protein
Produktgrößen
10 ug
£133,00
RP01518-10UG
20 ug
£181,00
RP01518-20UG
50 ug
£240,00
RP01518-50UG
100 ug
£353,00
RP01518-100UG
500 ug
£1002,00
RP01518-500UG
1000 ug
£1574,00
RP01518-1000UG
Über dieses Produkt
- SKU:
- RP01518
- Zusätzliche Namen:
- PRL,Prolactin,Gha1,Prl1a1,AV290867,PRL
- Weitere Details:
- Prolactin (PRL) is a hormone with multiple actions in the central nervous system (CNS) spanning from physiology to pathology. PRL exerts different actions through its receptors that can be found in both neurons and glial cells (astrocytes, microglia and oligodendrocytes) of the brain. It is generally believed that in vertebrates, prolactin (PRL) is predominantly synthesized and released by pituitary lactotrophs and plays important roles in many physiological processes via activation of PRL receptor (PRLR), including water and electrolyte balance, reproduction, growth and development, metabolism, immuno-modulation, and behavior.
- Formulierung:
- Recombinant Mouse Prolactin/PRL Protein is produced by HEK293 cells expression system. The target protein is expressed with sequence (Leu32-Cys228) of mouse Prolactin (Accession #NP_035294.2) fused wi
- Immunogen:
- Leu32-Cys228
- Molekulargewicht:
- 25-30 kDa
- Physischer Zustand:
- Lyophilized
- Reinheit:
- ≥95%
- Sequenz:
- LPICSAGDCQTSLRELFDRVVILSHYIHTLYTDMFIEFDKQYVQDREFMVKVINDCPTSSLATPEDKEQALKVPPEVLLNLILSLVQSSSDPLFQLITGVGGIQEAPEYILSRAKEIEEQNKQLLEGVEKIISQAYPEAKGNGIYFVWSQLPSLQGVDEESKILSLRNTIRCLRRDSHKVDNFLKVLRCQIAHQNNC
- Versandbedingungen:
- Blue Ice
- Lagerbedingungen:
- -20[o]C reconstituted. Avoid freeze/thaw cycles., 2-8[o]C reconstituted., -20[o]C/-70[o]C lyophilized. Avoid freeze/thaw cycles.
- Hersteller:
- ABclonal Technology
- Typ:
- Proteins, Peptides, Small Molecules & Other Biomolecules: Recombinant Proteins
- Datenblatt des Herstellers:RP01518