Recombinant Mouse TIGIT Protein
Produktgrößen
10 ug
£133,00
RP01516LQ-10UG
20 ug
£181,00
RP01516LQ-20UG
50 ug
£240,00
RP01516LQ-50UG
100 ug
£353,00
RP01516LQ-100UG
500 ug
£1027,00
RP01516LQ-500UG
1000 ug
£1599,00
RP01516LQ-1000UG
Über dieses Produkt
- SKU:
- RP01516LQ
- Zusätzliche Namen:
- TIGIT,VSIG9,VSTM3,TIGIT,TIGIT,VSIG9,VSTM3,TIGIT
- Weitere Details:
- TIGIT, also known as V-set and transmembrane domain-containing protein 3 (VSTM3) or V-set and immunoglobulin domain-containing protein 9 (VSIG9) is a new surface protein containing an immunoglobulin variable domain, a transmembrane domain and an immunoreceptor tyrosine-based inhibitory motif (ITIM). TIGIT is expressed on regulatory, memory, activated T cells and NK cells. It binds PVR with high affinity, and PVRL2 with lower affinity, but not PVRL3. Knockdown of TIGIT with siRNA in human memory T cells did not affect T cell responses, however, TIGIT inhibits NK cytotoxicity directly through its ITIM. TIGIT suppresses T cell activation by promoting the generation of mature immunoregulatory dendritic cells. The binding of PVR to TIGIT on human dendritic cells enhanced the production of IL-1 and diminished the production of IL-12p4. Also, TIGIT counter inhibits the NK-mediated killing of tumor cells and protects normal cells from NK-mediated cytotoxicity thus providing an "alternative self" mechanism for MHC class I inhibition.
- Formulierung:
- Recombinant Human TIGIT Protein is produced by HEK293 cells expression system. The target protein is expressed with sequence (Gly26-Gly141) of human TIGIT (Accession #NP_001139797.1) fused with a mFc
- Immunogen:
- Gly26-Gly141
- Molekulargewicht:
- 45-60 kDa
- Physischer Zustand:
- Lyophilized
- Reinheit:
- ≥90%
- Sequenz:
- GTIDTKRNISAEEGGSVILQCHFSSDTAEVTQVDWKQQDQLLAIYSVDLGWHVASVFSDRVVPGPSLGLTFQSLTMNDTGEYFCTYHTYPGGIYKGRIFLKVQESSVAQFQTAPLG
- Versandbedingungen:
- Dry Ice
- Lagerbedingungen:
- -70[o]C Aliquot. Avoid freeze/thaw cycles.
- Hersteller:
- ABclonal Technology
- Typ:
- Proteins, Peptides, Small Molecules & Other Biomolecules: Recombinant Proteins
- Datenblatt des Herstellers:RP01516LQ
