Recombinant Human GOLPH2/GOLM1 Protein
Produktgrößen
10 ug
£133,00
RP01505-10UG
20 ug
£181,00
RP01505-20UG
50 ug
£240,00
RP01505-50UG
100 ug
£353,00
RP01505-100UG
500 ug
£1002,00
RP01505-500UG
1000 ug
£1574,00
RP01505-1000UG
Über dieses Produkt
- SKU:
- RP01505
- Zusätzliche Namen:
- C9orf155, GOLPH2, GP73, HEL46, PSEC0257, bA379P1.3,GOLM1,GOLPH2,GP73,HEL46,PSEC0257,bA379P1.3
- Weitere Details:
- Golgi membrane protein 1, also known as Golgi membrane protein GP73, Golgi phosphoprotein 2, and GOLM1, is a protein that belongs to the GOLM1 / CASC4 family. GOLM1 is widely expressed. It is highly expressed in the colon, prostate, trachea, and stomach. It is expressed at a lower level in testis, muscle, lymphoid tissues, white blood cells, and spleen. It is predominantly expressed by cells of the epithelial lineage. GOLM1 is expressed at a low level in the normal liver. Expression significantly increases in virus (HBV, HCV) infected liver. Expression of GOLM1 does not increase in liver disease due to non-viral causes (alcohol-induced liver disease, autoimmune hepatitis). Increased expression in hepatocytes appears to be a general feature of advanced liver disease. In liver tissue from patients with adult giant-cell hepatitis (GCH), GOLM1 is strongly expressed in hepatocyte-derived syncytial giant cells. GOLM1 is constitutively expressed by biliary epithelial cells but not by hepatocytes.
- Formulierung:
- Recombinant Human GOLPH2/GOLM1 Protein is produced by HEK293 cells expression system. The target protein is expressed with sequence (Ser36-Leu401) of human GOLPH2/GOLM1 (Accession #NP_057632.2) fused
- Immunogen:
- Ser36-Leu401
- Molekulargewicht:
- 70-80 kDa
- Physischer Zustand:
- Lyophilized
- Reinheit:
- ≥95%
- Sequenz:
- SSRSVDLQTRIMELEGRVRRAAAERGAVELKKNEFQGELEKQREQLDKIQSSHNFQLESVNKLYQDEKAVLVNNITTGERLIRVLQDQLKTLQRNYGRLQQDVLQFQKNQTNLERKFSYDLSQCINQMKEVKEQCEERIEEVTKKGNEAVASRDLSENNDQRQQLQALSEPQPRLQAAGLPHTEVPQGKGNVLGNSKSQTPAPSSEVVLDSKRQVEKEETNEIQVVNEEPQRDRLPQEPGREQVVEDRPVGGRGFGGAGELGQTPQVQAALSVSQENPEMEGPERDQLVIPDGQEEEQEAAGEGRNQQKLRGEDDYNMDENEAESETDKQAALAGNDRNIDVFNVEDQKRDTINLLDQREKRNHTL
- Versandbedingungen:
- Blue Ice
- Lagerbedingungen:
- -20[o]C reconstituted. Avoid freeze/thaw cycles., 2-8[o]C reconstituted., -20[o]C/-70[o]C lyophilized. Avoid freeze/thaw cycles.
- Hersteller:
- ABclonal Technology
- Typ:
- Proteins, Peptides, Small Molecules & Other Biomolecules: Recombinant Proteins
- Datenblatt des Herstellers:RP01505