Recombinant Mouse IL-2RA/CD25 Protein
Produktgrößen
10 ug
£133,00
RP01481-10UG
500 ug
£1002,00
RP01481-500UG
1000 ug
£1574,00
RP01481-1000UG
Über dieses Produkt
- SKU:
- RP01481
- Zusätzliche Namen:
- CD25, Il2r, Ly-43, p55, CD25, IL2R, IMD41, TCGFR, IDDM10
- Weitere Details:
- The interleukin 2 (IL2) receptor alpha (IL2RA) and beta (IL2RB) chains, together with the common gamma chain (IL2RG), constitute the high-affinity IL2 receptor. Homodimeric alpha chains (IL2RA) result in low-affinity receptor, while homodimeric beta (IL2RB) chains produce a medium-affinity receptor. Normally an integral-membrane protein, soluble IL2RA has been isolated and determined to result from extracellular proteolyisis. Alternately-spliced IL2RA mRNAs have been isolated, but the significance of each is presently unknown.
- Formulierung:
- Recombinant Mouse IL-2RA/CD25 Protein is produced by HEK293 cells expression system. The target protein is expressed with sequence (Glu22-Lys236) of mouse CD25/IL-2Ralpha (Accession #NP_032393.3) fuse
- Immunogen:
- Glu22-Lys236
- Molekulargewicht:
- 55-70 kDa
- Physischer Zustand:
- Lyophilized
- Reinheit:
- ≥95%
- Sequenz:
- ELCLYDPPEVPNATFKALSYKNGTILNCECKRGFRRLKELVYMRCLGNSWSSNCQCTSNSHDKSRKQVTAQLEHQKEQQTTTDMQKPTQSMHQENLTGHCREPPPWKHEDSKRIYHFVEGQSVHYECIPGYKALQRGPAISICKMKCGKTGWTQPQLTCVDEREHHRFLASEESQGSRNSSPESETSCPITTTDFPQPTETTAMTETFVLTMEYK
- Versandbedingungen:
- Blue Ice
- Lagerbedingungen:
- -20[o]C reconstituted. Avoid freeze/thaw cycles., 2-8[o]C reconstituted., -20[o]C/-70[o]C lyophilized. Avoid freeze/thaw cycles.
- Hersteller:
- ABclonal Technology
- Typ:
- Proteins, Peptides, Small Molecules & Other Biomolecules: Recombinant Proteins
- Datenblatt des Herstellers:RP01481