Recombinant Mouse IL-5RA/CD125 Protein
Produktgrößen
10 ug
£145,00
RP01473-10UG
20 ug
£193,00
RP01473-20UG
50 ug
£288,00
RP01473-50UG
100 ug
£431,00
RP01473-100UG
500 ug
£1240,00
RP01473-500UG
1000 ug
£1954,00
RP01473-1000UG
Über dieses Produkt
- SKU:
- RP01473
- Zusätzliche Namen:
- Il5r,CD125,CDw125,IL5RA
- Weitere Details:
- Interleukin 5 receptor, alpha (IL5RA) also known as CD125 (Cluster of Differentiation 125) is a subunit of the Interleukin-5 receptor. IL5RA (CD125) is an interleukin 5 specific subunit of a heterodimeric cytokine receptor. The receptor is comprised of a ligand-specific alpha subunit and a signal transducing beta subunit shared by the receptors for interleukin 3 (IL3), colony-stimulating factor 2 (CSF2/GM-CSF), and interleukin 5 (IL5). The binding of this protein to IL5 depends on the beta subunit. The beta subunit is activated by the ligand binding and is required for the biological activities of IL5. This protein has been found to interact with syndecan binding protein (syntenin), which is required for IL5 mediated activation of the transcription factor SOX4. Six alternatively spliced transcript variants encoding three distinct isoforms have been reported. IL5RA (CD125) is a T-cell-derived cytokine that is particularly important in the development of asthma for the terminal differentiation, activation, and survival of committed eosinophil precursors.
- Formulierung:
- Recombinant Mouse IL-5RA/CD125 Protein is produced by HEK293 cells expression system. The target protein is expressed with sequence (Asp18-His339) of mouse IL5RA/CD125 (Accession #NP_032396.1) fused w
- Immunogen:
- Asp18-His339
- Molekulargewicht:
- 55 kDa
- Physischer Zustand:
- Lyophilized
- Reinheit:
- ≥95%
- Sequenz:
- DLLNHKKFLLLPPVNFTIKATGLAQVLLHWDPNPDQEQRHVDLEYHVKINAPQEDEYDTRKTESKCVTPLHEGFAASVRTILKSSHTTLASSWVSAELKAPPGSPGTSVTNLTCTTHTVVSSHTHLRPYQVSLRCTWLVGKDAPEDTQYFLYYRFGVLTEKCQEYSRDALNRNTACWFPRTFINSKGFEQLAVHINGSSKRAAIKPFDQLFSPLAIDQVNPPRNVTVEIESNSLYIQWEKPLSAFPDHCFNYELKIYNTKNGHIQKEKLIANKFISKIDDVSTYSIQVRAAVSSPCRMPGRWGEWSQPIYVGKERKSLVEWH
- Versandbedingungen:
- Blue Ice
- Lagerbedingungen:
- -20[o]C reconstituted. Avoid freeze/thaw cycles., 2-8[o]C reconstituted., -20[o]C/-70[o]C lyophilized. Avoid freeze/thaw cycles.
- Hersteller:
- ABclonal Technology
- Typ:
- Proteins, Peptides, Small Molecules & Other Biomolecules: Recombinant Proteins
- Datenblatt des Herstellers:RP01473