Recombinant Mouse Ephrin-B2/EFNB2 Protein
Produktgrößen
10 ug
£127,00
RP01468-10UG
20 ug
£175,00
RP01468-20UG
50 ug
£240,00
RP01468-50UG
100 ug
£336,00
RP01468-100UG
500 ug
£1002,00
RP01468-500UG
1000 ug
£1574,00
RP01468-1000UG
Über dieses Produkt
- SKU:
- RP01468
- Zusätzliche Namen:
- Epl5,ELF-2,Eplg5,Htk-L,Lerk5,LERK-5,NLERK-1,EFNB2
- Weitere Details:
- This protein is a member of the ephrin (EPH) family. The ephrins and EPH-related receptors comprise the largest subfamily of receptor protein-tyrosine kinases and have been implicated in mediating developmental events, especially in the nervous system and in erythropoiesis. Based on their structures and sequence relationships, ephrins are divided into the ephrin-A (EFNA) class, which are anchored to the membrane by a glycosylphosphatidylinositol linkage, and the ephrin-B (EFNB) class, which are transmembrane proteins. This gene encodes an EFNB class ephrin which binds to the EPHB4 and EPHA3 receptors.
- Formulierung:
- Recombinant Mouse Ephrin-B2/EFNB2 Protein is produced by HEK293 cells expression system. The target protein is expressed with sequence (Arg29-Ala232) of mouse Ephrin-B2/EFNB2 (Accession #NP_034241.2)
- Immunogen:
- Arg29-Ala232
- Molekulargewicht:
- 35-40 kDa
- Physischer Zustand:
- Lyophilized
- Reinheit:
- ≥95%
- Sequenz:
- RSIVLEPIYWNSSNSKFLPGQGLVLYPQIGDKLDIICPKVDSKTVGQYEYYKVYMVDKDQADRCTIKKENTPLLNCARPDQDVKFTIKFQEFSPNLWGLEFQKNKDYYIISTSNGSLEGLDNQEGGVCQTRAMKILMKVGQDASSAGSARNHGPTRRPELEAGTNGRSSTTSPFVKPNPGSSTDGNSAGHSGNNLLGSEVALFA
- Versandbedingungen:
- Blue Ice
- Lagerbedingungen:
- -20[o]C reconstituted. Avoid freeze/thaw cycles., 2-8[o]C reconstituted., -20[o]C/-70[o]C lyophilized. Avoid freeze/thaw cycles.
- Hersteller:
- ABclonal Technology
- Typ:
- Proteins, Peptides, Small Molecules & Other Biomolecules: Recombinant Proteins
- Datenblatt des Herstellers:RP01468

