Recombinant Human NKAT-6/KIR2DL2/CD158b1 Protein
Produktgrößen
10 ug
£133,00
RP01452-10UG
20 ug
£181,00
RP01452-20UG
50 ug
£240,00
RP01452-50UG
100 ug
£353,00
RP01452-100UG
500 ug
£1002,00
RP01452-500UG
1000 ug
£1574,00
RP01452-1000UG
Über dieses Produkt
- SKU:
- RP01452
- Zusätzliche Namen:
- KIR2DL2,CD158B1,CD158b,NKAT-6,NKAT6,p58.2
- Weitere Details:
- KIR2DL2 (2DL2, formerly NKAT6, designated CD158b) is a 348 amino acid (aa) type I transmembrane glycoprotein that belongs to the human killer cell Ig?like receptor (KIR) family. KIRs are expressed on human CD56dim NK cells and T cell subsets, and regulate effector functions in the innate immune system.KIR2DL2 is receptor on natural killer (NK) cells for HLA-Cw1, 3, 7, and 8 allotypes. Inhibits the activity of NK cells thus preventing cell lysis.
- Formulierung:
- Recombinant Human NKAT-6/KIR2DL2/CD158b1 Protein is produced by HEK293 cells expression system. The target protein is expressed with sequence (His22-His245) of human KIR2DL2 (Accession #NP_055034.2) f
- Immunogen:
- His22-His245
- Molekulargewicht:
- 40-55 kDa
- Physischer Zustand:
- Lyophilized
- Reinheit:
- ≥95%
- Sequenz:
- HEGVHRKPSLLAHPGRLVKSEETVILQCWSDVRFEHFLLHREGKFKDTLHLIGEHHDGVSKANFSIGPMMQDLAGTYRCYGSVTHSPYQLSAPSDPLDIVITGLYEKPSLSAQPGPTVLAGESVTLSCSSRSSYDMYHLSREGEAHECRFSAGPKVNGTFQADFPLGPATHGGTYRCFGSFRDSPYEWSNSSDPLLVSVIGNPSNSWPSPTEPSSKTGNPRHLH
- Versandbedingungen:
- Blue Ice
- Lagerbedingungen:
- -20[o]C reconstituted. Avoid freeze/thaw cycles., 2-8[o]C reconstituted., -20[o]C/-70[o]C lyophilized. Avoid freeze/thaw cycles.
- Hersteller:
- ABclonal Technology
- Typ:
- Proteins, Peptides, Small Molecules & Other Biomolecules: Recombinant Proteins
- Datenblatt des Herstellers:RP01452