Recombinant Mouse TROP-2/TACSTD2 Protein
Produktgrößen
10 ug
£127,00
RP01449-10UG
20 ug
£157,00
RP01449-20UG
50 ug
£223,00
RP01449-50UG
100 ug
£336,00
RP01449-100UG
500 ug
£907,00
RP01449-500UG
1000 ug
£1478,00
RP01449-1000UG
Über dieses Produkt
- SKU:
- RP01449
- Zusätzliche Namen:
- Ly97,EGP-1,TROP2,C80403,GA733-1,Trop2
- Weitere Details:
- TROP-2, also referred to as tumor-associated calcium signal transducer 2 (TACSTD2), GA733-1 or M1S1, is a cell surface glycoprotein highly expressed in a wide variety of epithelial cancers. In contrast, there is little or no expression of Trop-2 in adult somatic tissue. Because it is a cell surface protein that is selectively expressed in tumor cells, Trop-2 is a potential therapeutic target. The cytoplasmic tail of Trop-2 possesses potential serine and tyrosine phosphorylation sites and a phosphatidyl-inositol binding consensus sequence. Trop-2 transduces an intracellular calcium signal, which are consistent with the hypothesis that it acts as a cell surface receptor and support a search for a physiological ligand. TROP2 encoding by an intronless gene was originally defined by the monoclonal antibody GA733, and is a member of a family of at least two type I membrane proteins. The other known member is GA733-2, also called EpCAM and TROP1. It has been suggested by studies that the GA733-1 gene was formed by the retroposition of the GA733-2 gene via an mRNA intermediate.
- Formulierung:
- Recombinant Mouse TROP-2/TACSTD2 Protein is produced by HEK293 cells expression system. The target protein is expressed with sequence (Gln25-Gly270) of mouse TROP-2/TACSTD2 (Accession #NP_064431.2) fu
- Immunogen:
- Gln25-Gly270
- Molekulargewicht:
- 40-55 kDa
- Physischer Zustand:
- Lyophilized
- Reinheit:
- ≥95%
- Sequenz:
- QSNCTCPTNKMTVCDTNGPGGVCQCRAMGSQVLVDCSTLTSKCLLLKARMSARKSGRSLVMPSEHAILDNDGLYDPECDDKGRFKARQCNQTSVCWCVNSVGVRRTDKGDQSLRCDEVVRTHHILIELRHRPTDRAFNHSDLDSELRRLFQERYKLHPSFLSAVHYEEPTIQIELRQNASQKGLRDVDIADAAYYFERDIKGESLFMGRRGLDVQVRGEPLHVERTLIYYLDEKPPQFSMKRLTAG
- Versandbedingungen:
- Blue Ice
- Lagerbedingungen:
- -20[o]C reconstituted. Avoid freeze/thaw cycles., 2-8[o]C reconstituted., -20[o]C/-70[o]C lyophilized. Avoid freeze/thaw cycles.
- Hersteller:
- ABclonal Technology
- Typ:
- Proteins, Peptides, Small Molecules & Other Biomolecules: Recombinant Proteins
- Datenblatt des Herstellers:RP01449