Recombinant Mouse Mesothelin/MSLN Protein
Produktgrößen
10 ug
£133,00
RP01448-10UG
20 ug
£181,00
RP01448-20UG
50 ug
£240,00
RP01448-50UG
100 ug
£353,00
RP01448-100UG
500 ug
£1002,00
RP01448-500UG
1000 ug
£1574,00
RP01448-1000UG
Über dieses Produkt
- SKU:
- RP01448
- Zusätzliche Namen:
- MSLN,Mesothelin,MPF,MSLN
- Weitere Details:
- The megakaryocyte potentiating factor belongs to the mesothelin family. This family is comprised of several mammalian pre-pro-megakaryocyte potentiating factor precursor (MPF) or mesothelin proteins. Mesothelin is a glycosylphosphatidylinositol-linked glycoprotein highly expressed in mesothelial cells, mesotheliomas, and ovarian cancer, but the biological function of the protein is not known. Megakaryocyte potentiating factor is highly expressed in mesotheliomas, ovarian cancers, and some squamous cell carcinomas (at protein level). It interacts with MUC16 and potentiates megakaryocyte colony formation in vitro. Megakaryocyte potentiating factor is secreted by several mesothelioma cell lines and is frequently elevated in the blood of patients with mesothelioma. Measurement of this protein may be useful in following the response of mesothelioma to treatment.
- Formulierung:
- Recombinant Mouse Mesothelin/MSLN Protein is produced by HEK293 cells expression system. The target protein is expressed with sequence (Asp298-Ser600) of mouse MSLN/Mesothelin (Accession #NP_061345.1)
- Immunogen:
- Asp298-Ser600
- Molekulargewicht:
- 40-50 kDa
- Physischer Zustand:
- Lyophilized
- Reinheit:
- ≥95%
- Sequenz:
- DAEQKACPPGKEPYKVDEDLIFYQNWELEACVDGTMLARQMDLVNEIPFTYEQLSIFKHKLDKTYPQGYPESLIQQLGHFFRYVSPEDIHQWNVTSPDTVKTLLKVSKGQKMNAQAIALVACYLRGGGQLDEDMVKALGDIPLSYLCDFSPQDLHSVPSSVMWLVGPQDLDKCSQRHLGLLYQKACSAFQNVSGLEYFEKIKTFLGGASVKDLRALSQHNVSMDIATFKRLQVDSLVGLSVAEVQKLLGPNIVDLKTEEDKSPVRDWLFRQHQKDLDRLGLGLQGGIPNGYLVLDFNVREAFS
- Versandbedingungen:
- Blue Ice
- Lagerbedingungen:
- -20[o]C reconstituted. Avoid freeze/thaw cycles., 2-8[o]C reconstituted., -20[o]C/-70[o]C lyophilized. Avoid freeze/thaw cycles.
- Hersteller:
- ABclonal Technology
- Typ:
- Proteins, Peptides, Small Molecules & Other Biomolecules: Recombinant Proteins
- Datenblatt des Herstellers:RP01448
