Recombinant Human TNFSF12/TWEAK Protein
Produktgrößen
10 ug
£145,00
RP01446-10UG
20 ug
£193,00
RP01446-20UG
50 ug
£288,00
RP01446-50UG
100 ug
£431,00
RP01446-100UG
500 ug
£1240,00
RP01446-500UG
1000 ug
£1954,00
RP01446-1000UG
Über dieses Produkt
- SKU:
- RP01446
- Zusätzliche Namen:
- TNFSF12,APO3L,DR3LG,TNLG4A,TWEAK
- Weitere Details:
- TNFSF12 is a cytokine that belongs to the tumor necrosis factor (TNF) ligand family. It is a ligand for the FN14/TWEAKR receptor. TNFSF12 has overlapping signaling functions with TNF, but displays a much wider tissue distribution. It can induce apoptosis via multiple pathways of cell death in a cell type-specific manner. It is also found that TNFSF12 promotes proliferation and migration of endothelial cells, and thus acts as a regulator of angiogenesis. TNFSF12 also is a weak inducer of apoptosis in some cell types and mediates NF-kappa-B activation.
- Formulierung:
- Recombinant Human TNFSF12/TWEAK Protein is produced by E. coli expression system. The target protein is expressed with sequence (Lys97-His249 (N-Met)) of human TWEAK/TNFSF12 (Accession #NP_003800.1) f
- Immunogen:
- Lys97-His249 (N-Met)
- Molekulargewicht:
- 15-20 kDa
- Physischer Zustand:
- Lyophilized
- Reinheit:
- ≥95%
- Sequenz:
- KGRKTRARRAIAAHYEVHPRPGQDGAQAGVDGTVSGWEEARINSSSPLRYNRQIGEFIVTRAGLYYLYCQVHFDEGKAVYLKLDLLVDGVLALRCLEEFSATAASSLGPQLRLCQVSGLLALRPGSSLRIRTLPWAHLKAAPFLTYFGLFQVH
- Versandbedingungen:
- Blue Ice
- Lagerbedingungen:
- -20[o]C reconstituted. Avoid freeze/thaw cycles., 2-8[o]C reconstituted., -20[o]C/-70[o]C lyophilized. Avoid freeze/thaw cycles.
- Hersteller:
- ABclonal Technology
- Typ:
- Proteins, Peptides, Small Molecules & Other Biomolecules: Recombinant Proteins
- Datenblatt des Herstellers:RP01446
