Recombinant Human VEGF-D/FIGF Protein
Produktgrößen
10 ug
£133,00
RP01426-10UG
20 ug
£181,00
RP01426-20UG
50 ug
£240,00
RP01426-50UG
100 ug
£353,00
RP01426-100UG
500 ug
£1002,00
RP01426-500UG
1000 ug
£1574,00
RP01426-1000UG
Über dieses Produkt
- SKU:
- RP01426
- Zusätzliche Namen:
- VEGFD, FIGF, VEGF-D, vascular endothelial growth factor D,FIGF,VEGF-D
- Weitere Details:
- Vascular endothelial growth factor D (VEGF-D), also known as C-fos induced growth factor (FIGF), belongs to the platelet-derived growth factor/vascular endothelial growth factor (PDGF/VEGF) family. FIGF protein is active in angiogenesis, lymphangiogenesis, and endothelial cell growth. FIGF protein is secreted as a non-covelent homodimer in an antiparallel fashion. Human FIGF protein is expressed in adult lung, heart, muscle, and small intestine, and is most abundantly expressed in fetal lungs and skin. FIGF protein is structurally and functionally similar to VEGF-C. Therefore, FIGF protein binds and activates VEGFR-2 (Flk1) and VEGFR-3 (Flt4) receptors, and may particularly be involved in cancers, such as breast cancer, epithelial ovarian carcinoma and so on.
- Formulierung:
- Recombinant Human VEGF-D/FIGF Protein is produced by HEK293 cells expression system. The target protein is expressed with sequence (Phe93-Ser201) of human VEGF-D/FIGF (Accession #NP_004460.1) fused wi
- Immunogen:
- Phe93-Ser201
- Molekulargewicht:
- 15-25 kDa
- Physischer Zustand:
- Lyophilized
- Reinheit:
- ≥95%
- Sequenz:
- FYDIETLKVIDEEWQRTQCSPRETCVEVASELGKSTNTFFKPPCVNVFRCGGCCNEESLICMNTSTSYISKQLFEISVPLTSVPELVPVKVANHTGCKCLPTAPRHPYS
- Versandbedingungen:
- Blue Ice
- Lagerbedingungen:
- -20[o]C reconstituted. Avoid freeze/thaw cycles., 2-8[o]C reconstituted., -20[o]C/-70[o]C lyophilized. Avoid freeze/thaw cycles.
- Hersteller:
- ABclonal Technology
- Typ:
- Proteins, Peptides, Small Molecules & Other Biomolecules: Recombinant Proteins
- Datenblatt des Herstellers:RP01426

