Recombinant Human Frizzled-2/FZD2 Protein
Produktgrößen
10 ug
£133,00
RP01422-10UG
50 ug
£240,00
RP01422-50UG
100 ug
£353,00
RP01422-100UG
500 ug
£1002,00
RP01422-500UG
1000 ug
£1574,00
RP01422-1000UG
Über dieses Produkt
- SKU:
- RP01422
- Zusätzliche Namen:
- Fz2, fz-2, fzE2, hFz2, OMOD2,FZD2
- Weitere Details:
- Frizzled-2 (FZD2) is also known as FzE2, which belongs to the G-protein coupled receptor Fz/Smo family. Most of frizzled receptors are coupled to the beta-catenin canonical signaling pathway, which leads to the activation of disheveled proteins, inhibition of GSK-3 kinase, nuclear accumulation of beta-catenin and activation of Wnt target genes. FZD2 contains one FZ (frizzled) domain. FZD2 may be involved in transduction and intercellular transmission of polarity information during tissue morphogenesis and/or in differentiated tissues. The Lys-Thr-X-X-X-Trp motif of FZD2 interacts with the PDZ doman of Dvl (Disheveled) family members and is involved in the activation of the Wnt/beta-catenin signaling pathway.
- Formulierung:
- Recombinant Human Frizzled-2/FZD2 Protein is produced by HEK293 cells expression system. The target protein is expressed with sequence (Gln24-Leu163) of human Frizzled-2/FZD2 (Accession #NP_001457.1)
- Immunogen:
- Gln24-Leu163
- Molekulargewicht:
- 50-55 kDa
- Physischer Zustand:
- Lyophilized
- Reinheit:
- ≥95%
- Sequenz:
- QFHGEKGISIPDHGFCQPISIPLCTDIAYNQTIMPNLLGHTNQEDAGLEVHQFYPLVKVQCSPELRFFLCSMYAPVCTVLEQAIPPCRSICERARQGCEALMNKFGFQWPERLRCEHFPRHGAEQICVGQNHSEDGAPAL
- Versandbedingungen:
- Blue Ice
- Lagerbedingungen:
- -20[o]C reconstituted. Avoid freeze/thaw cycles., 2-8[o]C reconstituted., -20[o]C/-70[o]C lyophilized. Avoid freeze/thaw cycles.
- Hersteller:
- ABclonal Technology
- Typ:
- Proteins, Peptides, Small Molecules & Other Biomolecules: Recombinant Proteins
- Datenblatt des Herstellers:RP01422