Recombinant Human VSIG3/IgSF11 Protein
Produktgrößen
10 ug
£133,00
RP01410-10UG
20 ug
£181,00
RP01410-20UG
50 ug
£240,00
RP01410-50UG
100 ug
£353,00
RP01410-100UG
500 ug
£1002,00
RP01410-500UG
1000 ug
£1574,00
RP01410-1000UG
Über dieses Produkt
- SKU:
- RP01410
- Zusätzliche Namen:
- BT-IgSF,CT119,CXADRL1,Igsf13,VSIG3,IGSF11
- Weitere Details:
- Immunoglobulin superfamily member 11(IGSF11) is expressed on the plasma membrane in the testis and brain. These IGSF proteins undergo final modifications during capacitation and/or the acrosome reaction. IGSF proteins share significant homology with endothelial cell-selective adhesion molecule and coxsackievirus and adenovirus receptor, which mediates cell attachment and homotypic intercellular interactions. In clinical, the IGSF11 has been reported to overexpressed in colorectal cancers and hepatocellular carcinomas, as well as intestinal-type gastric cancers, compared to their corresponding non-cancerous tissues. The IGSF11 has also been found expressed abundantly in the testis and ovary and the IGSF11 can be used as a candidate of cancer-testis antigen.
- Formulierung:
- Recombinant Human VSIG3/IgSF11 Protein is produced by HEK293 cells expression system. The target protein is expressed with sequence (Leu23-Gly241) of human VSIG3/IGSF11 (Accession #NP_001015887.1) fus
- Immunogen:
- Leu23-Gly241
- Molekulargewicht:
- 36-38 kDa
- Physischer Zustand:
- Lyophilized
- Reinheit:
- ≥95%
- Sequenz:
- LEVSESPGSIQVARGQPAVLPCTFTTSAALINLNVIWMVTPLSNANQPEQVILYQGGQMFDGAPRFHGRVGFTGTMPATNVSIFINNTQLSDTGTYQCLVNNLPDIGGRNIGVTGLTVLVPPSAPHCQIQGSQDIGSDVILLCSSEEGIPRPTYLWEKLDNTLKLPPTATQDQVQGTVTIRNISALSSGLYQCVASNAIGTSTCLLDLQVISPQPRNIG
- Versandbedingungen:
- Blue Ice
- Lagerbedingungen:
- -20[o]C reconstituted. Avoid freeze/thaw cycles., 2-8[o]C reconstituted., -20[o]C/-70[o]C lyophilized. Avoid freeze/thaw cycles.
- Hersteller:
- ABclonal Technology
- Typ:
- Proteins, Peptides, Small Molecules & Other Biomolecules: Recombinant Proteins
- Datenblatt des Herstellers:RP01410