Recombinant Human TGFR-1/ALK-5 Protein
Produktgrößen
10 ug
£133,00
RP01408-10UG
20 ug
£181,00
RP01408-20UG
50 ug
£240,00
RP01408-50UG
100 ug
£353,00
RP01408-100UG
500 ug
£1002,00
RP01408-500UG
1000 ug
£1574,00
RP01408-1000UG
Über dieses Produkt
- SKU:
- RP01408
- Zusätzliche Namen:
- TGFBR1,AAT5,ACVRLK4,ALK-5,ALK5,ESS1,LDS1,LDS1A,LDS2A,MSSE,SKR4,TGFR-1,tbetaR-I,TBRI,TBR-i
- Weitere Details:
- Transforming growth factor, beta receptor I, also known as Transforming growth factor-beta receptor type I , Serine / threonine-protein kinase receptor R4, Activin receptor-like kinase 5, SKR4, ALK-5, and TGFBR1, is a single-pass type I membrane protein that belongs to the protein kinase superfamily and TGFB receptor subfamily. TGFBR1 / ALK-5 is found in all tissues examined. It is most abundant in placenta and least abundant in brain and heart. TGF-beta functions as a tumor suppressor by inhibiting the cell cycle in the G1 phase. Administration of TGF-beta is able to protect against mammary tumor development in transgenic mouse models in vivo. Disruption of the TGF-beta/SMAD pathway has been implicated in a variety of human cancers, with the majority of colon and gastric cancers being caused by an inactivating mutation of TGF-beta RII. On ligand binding, TGFBR1 / ALK-5 forms a receptor complex consisting of two type I I and two type I transmembrane serine/threonine kinases. Type II receptors phosphorylate and activate type I receptors which auto-phosphorylate, then bind and activate SMAD transcriptional regulators.
- Formulierung:
- Recombinant Human TGFR-1/ALK-5 Protein is produced by HEK293 cells expression system. The target protein is expressed with sequence (Met1-Glu125) of human TGFBR1/ALK5 (Accession #NP_004603.1) fused wi
- Immunogen:
- Met1-Glu125
- Molekulargewicht:
- 40-55 kDa
- Physischer Zustand:
- Lyophilized
- Reinheit:
- ≥95%
- Sequenz:
- MEAAVAAPRPRLLLLVLAAAAAAAAALLPGATALQCFCHLCTKDNFTCVTDGLCFVSVTETTDKVIHNSMCIAEIDLIPRDRPFVCAPSSKTGSVTTTYCCNQDHCNKIELPTTVKSSPGLGPVE
- Versandbedingungen:
- Blue Ice
- Lagerbedingungen:
- -20[o]C reconstituted. Avoid freeze/thaw cycles., 2-8[o]C reconstituted., -20[o]C/-70[o]C lyophilized. Avoid freeze/thaw cycles.
- Hersteller:
- ABclonal Technology
- Typ:
- Proteins, Peptides, Small Molecules & Other Biomolecules: Enzymes
- Datenblatt des Herstellers:RP01408
