Recombinant Human Fc epsilon RII/CD23 Protein
Produktgrößen
10 ug
£133,00
RP01407-10UG
20 ug
£181,00
RP01407-20UG
50 ug
£240,00
RP01407-50UG
100 ug
£353,00
RP01407-100UG
500 ug
£1002,00
RP01407-500UG
1000 ug
£1574,00
RP01407-1000UG
Über dieses Produkt
- SKU:
- RP01407
- Zusätzliche Namen:
- BLAST-2, CD23, CD23A, CLEC4J, FCE2, IGEBF,FCER2, BLAST-2, Fc fragment of IgE receptor II,CD23,CD23A,CLEC4J,FCE2,IGEBF
- Weitere Details:
- Fc fragment of IgE, low affinity II, receptor for (CD23) or CD23 antigen is a member of the cluster of differentiation family. The cluster of differentiation (cluster of designation) (often abbreviated as CD) is a protocol used for the identification and investigation of cell surface molecules present on white blood cells initially but found in almost any kind of cell of the body, providing targets for immunophenotyping of cells. Physiologically, CD molecules can act in numerous ways, often acting as receptors or ligands (the molecule that activates a receptor) important to the cell. A signal cascade is usually initiated, altering the behavior of the cell (see cell signaling). Some CD proteins do not play a role in cell signaling, but have other functions, such as cell adhesion. CD23/FCER2 is a B-cell specific antigen, and a low-affinity receptor for IgE. It has essential roles in B cell growth and differentiation, and the regulation of IgE production. This protein also exists as a soluble secreted form, then functioning as a potent mitogenic growth factor. Increased levels of soluble CD23/FCER2 cause the recruitment of non-sensitised B-cells in the presentation of antigen peptides to allergen-specific B-cells, therefore increasing the production of allergen specific IgE. IgE, in turn, is known to upregulate the cellular expression of CD23 and Fc epsilon RI (high-affinity IgE receptor).
- Formulierung:
- Recombinant Human Fc epsilon RII/CD23 Protein is produced by HEK293 cells expression system. The target protein is expressed with sequence (Asp 48-Ser321) of human CD23/Fc epsilon RII (Accession #NP_0
- Immunogen:
- Asp48-Ser321
- Molekulargewicht:
- 40 kDa
- Physischer Zustand:
- Lyophilized
- Reinheit:
- ≥95%
- Sequenz:
- DTTQSLKQLEERAARNVSQVSKNLESHHGDQMAQKSQSTQISQELEELRAEQQRLKSQDLELSWNLNGLQADLSSFKSQELNERNEASDLLERLREEVTKLRMELQVSSGFVCNTCPEKWINFQRKCYYFGKGTKQWVHARYACDDMEGQLVSIHSPEEQDFLTKHASHTGSWIGLRNLDLKGEFIWVDGSHVDYSNWAPGEPTSRSQGEDCVMMRGSGRWNDAFCDRKLGAWVCDRLATCTPPASEGSAESMGPDSRPDPDGRLPTPSAPLHS
- Versandbedingungen:
- Blue Ice
- Lagerbedingungen:
- -20[o]C reconstituted. Avoid freeze/thaw cycles., 2-8[o]C reconstituted., -20[o]C/-70[o]C lyophilized. Avoid freeze/thaw cycles.
- Hersteller:
- ABclonal Technology
- Typ:
- Proteins, Peptides, Small Molecules & Other Biomolecules: Recombinant Proteins
- Datenblatt des Herstellers:RP01407