Recombinant Human FGF-3 Protein
Produktgrößen
10 ug
£133,00
RP01404-10UG
20 ug
£181,00
RP01404-20UG
50 ug
£240,00
RP01404-50UG
100 ug
£353,00
RP01404-100UG
500 ug
£1002,00
RP01404-500UG
1000 ug
£1574,00
RP01404-1000UG
Über dieses Produkt
- SKU:
- RP01404
- Zusätzliche Namen:
- FGF3,HBGF-3,INT2
- Weitere Details:
- Fibroblast Growth Factor 3 (FGF-3) belongs to the large FGF family which has at least 23 members. All FGF family members are heparin-binding growth factors with a core 120 amino acid (aa) FGF domain that allows for a common tertiary structure. FGFs are expressed during embryonic development and in restricted adult tissues. They act on cells of mesodermal and neuroectodermal origin to regulate diverse physiologic functions including angiogenesis, cell growth, pattern formation, embryonic development, metabolic regulation, cell migration, neurotrophic effects and tissue repair. Signaling receptors for FGFs are type I transmembrane receptor tyrosine kinases belonging to the Ig superfamily. Four distinct but related classes of FGF receptors, FGF R1, 2, 3, and 4, exist. Through alternative splicing, multiple isoforms for FGF R1, 2 and 3, with distinct ligand recognition profiles, are also generated.
- Formulierung:
- Recombinant Human FGF-3 Protein is produced by E. coli expression system. The target protein is expressed with sequence (Asp28-Arg212 (N-Met) ) of human FGF-3 (Accession #NP_005238.1) fused with no ad
- Immunogen:
- Asp28-Arg212 (N-Met)
- Molekulargewicht:
- Approximately 25 kDa
- Physischer Zustand:
- Lyophilized
- Reinheit:
- ≥95%
- Sequenz:
- DAGGRGGVYEHLGGAPRRRKLYCATKYHLQLHPSGRVNGSLENSAYSILEITAVEVGIVAIRGLFSGRYLAMNKRGRLYASEHYSAECEFVERIHELGYNTYASRLYRTVSSTPGARRQPSAERLWYVSVNGKGRPRRGFKTRRTQKSSLFLPRVLDHRDHEMVRQLQSGLPRPPGKGVQPRRRR
- Versandbedingungen:
- Blue Ice
- Lagerbedingungen:
- -20[o]C reconstituted. Avoid freeze/thaw cycles., 2-8[o]C reconstituted., -20[o]C/-70[o]C lyophilized. Avoid freeze/thaw cycles.
- Hersteller:
- ABclonal Technology
- Typ:
- Proteins, Peptides, Small Molecules & Other Biomolecules: Recombinant Proteins
- Datenblatt des Herstellers:RP01404