Recombinant Human CXCL3/GRO-gamma/MIP2-beta Protein
Produktgrößen
10 ug
£133,00
RP01403-10UG
20 ug
£181,00
RP01403-20UG
50 ug
£240,00
RP01403-50UG
100 ug
£353,00
RP01403-100UG
500 ug
£1002,00
RP01403-500UG
1000 ug
£1574,00
RP01403-1000UG
Über dieses Produkt
- SKU:
- RP01403
- Zusätzliche Namen:
- CXCL3,CINC-2b,GRO3,GROg,MIP-2b,MIP2B,SCYB3
- Weitere Details:
- CXCL3 is involved in migration, invasion, proliferation and tubule formation of trophoblasts and may play a key role in the pathogenesis of preeclampsia. CXCL3 autocrine/paracrine pathways are involved in the development of prostate cancer by regulating the expression of the target genes that are related to the progression of malignancies. CXCL3 is a novel adipokine that facilitates adipogenesis in an autocrine and/or a paracrine manner through induction of c/ebpb and c/ebpd. CXCL3 and its receptor CXCR2 are overexpressed in prostate cancer cells, prostate epithelial cells and prostate cancer tissues, which may play multiple roles in prostate cancer progression and metastasis.
- Formulierung:
- Recombinant Human CXCL3/GRO-gamma/MIP2-beta Protein is produced by E. coli expression system. The target protein is expressed with sequence (Ala35-Asn107) of human CXCL3/GRO gamma (Accession #NP_00208
- Immunogen:
- Ala35-Asn107
- Molekulargewicht:
- 10-15 kDa
- Physischer Zustand:
- Lyophilized
- Reinheit:
- ≥85%
- Sequenz:
- ASVVTELRCQCLQTLQGIHLKNIQSVNVRSPGPHCAQTEVIATLKNGKKACLNPASPMVQKIIEKILNKGSTN
- Versandbedingungen:
- Blue Ice
- Lagerbedingungen:
- -20[o]C reconstituted. Avoid freeze/thaw cycles., 2-8[o]C reconstituted., -20[o]C/-70[o]C lyophilized. Avoid freeze/thaw cycles.
- Hersteller:
- ABclonal Technology
- Typ:
- Proteins, Peptides, Small Molecules & Other Biomolecules: Recombinant Proteins
- Datenblatt des Herstellers:RP01403