Recombinant Mouse Fc-gamma RIV/FCGR3A/CD16a Protein
Produktgrößen
10 ug
£133,00
RP01394-10UG
20 ug
£181,00
RP01394-20UG
50 ug
£240,00
RP01394-50UG
100 ug
£353,00
RP01394-100UG
500 ug
£1002,00
RP01394-500UG
1000 ug
£1574,00
RP01394-1000UG
Über dieses Produkt
- SKU:
- RP01394
- Zusätzliche Namen:
- Fc gamma RIV,CD16-2,Fcgr4,FCGR4,mouse igg,FcgR4
- Weitere Details:
- FcgammaRIV is a relatively new IgG Fc receptor (FcgammaR) that is reported to contribute to the pathogenesis of autoimmune diseases.FcgammaRIII and FcgammaRIV are each essential to trigger an FcRgamma-linker for activation of T-cell-dependent signal that drives C5a production in the Arthus reaction. A combined requirement for FcgammaRIII and FcgammaRIV in autoimmune injury, and identify the linker for activation of T cells adaptor as an integral component of linked FcgammaR and C5a anaphylatoxin receptor activation to generate inflammation.
- Formulierung:
- Recombinant Mouse Fc-gamma RIV/FCGR3A/CD16a Protein is produced by HEK293 cells expression system. The target protein is expressed with sequence (Gly21-Gln 203) of mouse Fc gamma RIV/CD16-2 (Accession
- Immunogen:
- Gly21-Gln203
- Molekulargewicht:
- 35-40 kDa
- Physischer Zustand:
- Lyophilized
- Reinheit:
- ≥95%
- Sequenz:
- GLQKAVVNLDPKWVRVLEEDSVTLRCQGTFSPEDNSIKWFHNESLIPHQDANYVIQSARVKDSGMYRCQTALSTISDPVQLEVHMGWLLLQTTKWLFQEGDPIHLRCHSWQNRPVRKVTYLQNGKGKKYFHENSELLIPKATHNDSGSYFCRGLIGHNNKSSASFRISLGDPGSPSMFPPWHQ
- Versandbedingungen:
- Blue Ice
- Lagerbedingungen:
- -20[o]C reconstituted. Avoid freeze/thaw cycles., 2-8[o]C reconstituted., -20[o]C/-70[o]C lyophilized. Avoid freeze/thaw cycles.
- Hersteller:
- ABclonal Technology
- Typ:
- Proteins, Peptides, Small Molecules & Other Biomolecules: Recombinant Proteins
- Datenblatt des Herstellers:RP01394