Recombinant Human NKAT-2/KIR2DL3/CD158b2 Protein
Produktgrößen
10 ug
£133,00
RP01389-10UG
20 ug
£181,00
RP01389-20UG
50 ug
£240,00
RP01389-50UG
100 ug
£353,00
RP01389-100UG
500 ug
£1002,00
RP01389-500UG
1000 ug
£1574,00
RP01389-1000UG
Über dieses Produkt
- SKU:
- RP01389
- Zusätzliche Namen:
- KIR2DL3,CD158B2,CD158b,GL183,KIR-023GB,KIR-K7b,KIR-K7c,KIR2DS5,KIRCL23,NKAT,NKAT2,NKAT2A,NKAT2B,p58
- Weitere Details:
- Killer cell immunoglobulin-like receptor 2DL3, also known as CD158 antigen-like family member B2, KIR-23GB, Killer inhibitory receptor cl 2-3, MHC class I NK cell receptor, NKAT2a, NKAT2b, Natural killer-associated transcript 2, p58 natural killer cell receptor clone CL-6, p58.2 MHC class-I-specific NK receptor, CD158b2, and KIR2DL3, is a single-pass type I membrane protein which belongs to the immunoglobulin superfamily. KIR2DL3 contains 2 Ig-like C2-type (immunoglobulin-like) domains. KIR2DL3 interacts with ARRB2. KIR2DL3 is a receptor on natural killer (NK) cells for HLA-C alleles (HLA-Cw1, HLA-Cw3, and HLA-Cw7). KIR2DL3 inhibits the activity of NK cells thus preventing cell lysis.
- Formulierung:
- Recombinant Human NKAT-2/KIR2DL3/CD158b2 Protein is produced by HEK293 cells expression system. The target protein is expressed with sequence (His22-His245) of human KIR2DL3/CD158b2 (Accession #NP_056
- Immunogen:
- His22-His245
- Molekulargewicht:
- 35-50 kDa
- Physischer Zustand:
- Lyophilized
- Reinheit:
- ≥95%
- Sequenz:
- HEGVHRKPSLLAHPGPLVKSEETVILQCWSDVRFQHFLLHREGKFKDTLHLIGEHHDGVSKANFSIGPMMQDLAGTYRCYGSVTHSPYQLSAPSDPLDIVITGLYEKPSLSAQPGPTVLAGESVTLSCSSRSSYDMYHLSREGEAHERRFSAGPKVNGTFQADFPLGPATHGGTYRCFGSFRDSPYEWSNSSDPLLVSVTGNPSNSWPSPTEPSSETGNPRHLH
- Versandbedingungen:
- Blue Ice
- Lagerbedingungen:
- -20[o]C reconstituted. Avoid freeze/thaw cycles., 2-8[o]C reconstituted., -20[o]C/-70[o]C lyophilized. Avoid freeze/thaw cycles.
- Hersteller:
- ABclonal Technology
- Typ:
- Proteins, Peptides, Small Molecules & Other Biomolecules: Recombinant Proteins
- Datenblatt des Herstellers:RP01389
