Recombinant Human Frizzled-4/FZD4/CD344 Protein
Produktgrößen
10 ug
£127,00
RP01377-10UG
20 ug
£157,00
RP01377-20UG
50 ug
£223,00
RP01377-50UG
100 ug
£336,00
RP01377-100UG
500 ug
£937,00
RP01377-500UG
1000 ug
£1478,00
RP01377-1000UG
Über dieses Produkt
- SKU:
- RP01377
- Zusätzliche Namen:
- FZD4,CD344,EVR1,FEVR,FZD4S,Fz-4,Fz4,FzE4,GPCR,hFz4
- Weitere Details:
- Frizzled-4 (FZD4) is also known as FzE4, CD344, which belongs to the G-protein coupled receptor Fz/Smo family. Most of frizzled receptors are coupled to the beta-catenin canonical signaling pathway, which leads to the activation of disheveled proteins, inhibition of GSK-3 kinase, nuclear accumulation of beta-catenin and activation of Wnt target genes.Familial exudative vitreoretinopathy (FEVR) is a hereditary blinding disorder that features defects in retinal vascular development. Mutations in FZD4 are known to cause autosomal dominant exudative vitreoretinopathy (EVR1). The mutations in FZD4 are associated with the phenotypes of retinal folds or ectopic macula in FEVR.
- Formulierung:
- Recombinant Human Frizzled-4/FZD4/CD344 Protein is produced by HEK293 cells expression system. The target protein is expressed with sequence (Phe37-Glu180) of human FZD4/CD344/EVR1 (Accession #NP_0363
- Immunogen:
- Phe37-Glu180
- Molekulargewicht:
- 55-60 kDa
- Physischer Zustand:
- Lyophilized
- Reinheit:
- ≥95%
- Sequenz:
- FGDEEERRCDPIRISMCQNLGYNVTKMPNLVGHELQTDAELQLTTFTPLIQYGCSSQLQFFLCSVYVPMCTEKINIPIGPCGGMCLSVKRRCEPVLKEFGFAWPESLNCSKFPPQNDHNHMCMEGPGDEEVPLPHKTPIQPGEE
- Versandbedingungen:
- Blue Ice
- Lagerbedingungen:
- -20[o]C reconstituted. Avoid freeze/thaw cycles., 2-8[o]C reconstituted., -20[o]C/-70[o]C lyophilized. Avoid freeze/thaw cycles.
- Hersteller:
- ABclonal Technology
- Typ:
- Proteins, Peptides, Small Molecules & Other Biomolecules: Recombinant Proteins
- Datenblatt des Herstellers:RP01377