Recombinant Human CCL17/TARC Protein
Produktgrößen
50 ug
£240,00
RP01374-50UG
100 ug
£336,00
RP01374-100UG
500 ug
£1002,00
RP01374-500UG
1000 ug
£1574,00
RP01374-1000UG
Über dieses Produkt
- SKU:
- RP01374
- Zusätzliche Namen:
- CCL17,A-152E5.3,ABCD-2,SCYA17,TARC
- Weitere Details:
- There are four members of the chemokine family: C-C kemokines, C kemokines, CXC kemokines and CX3C kemokines. The C-C kemokines have two cysteines nearby the amino terminus. There have been at least 27 distinct members of this subgroup reported for mammals, called C-C chemokine ligands-1 to 28. Chemokin ligand 17 (CCL17), also known as thymus and activation regulated chemokine(TARC), is a small cytokine belonging to the C-C chemokine family. CCL17 is expressed maily in thymus and transiently in phytohemagglutinin-stimulated peripheral blood mononuclear cells. CCL17 can induce chemotaxis in T cells by binding with the chemokine receptor CCR4.
- Formulierung:
- Recombinant Human CCL17/TARC Protein is produced by HEK293 cells expression system. The target protein is expressed with sequence (Ala24-Ser94) of human CCL17/TARC (Accession #NP_002978.1) fused with
- Immunogen:
- Ala24-Ser94
- Molekulargewicht:
- 35-40 kDa
- Physischer Zustand:
- Lyophilized
- Reinheit:
- ≥90%
- Sequenz:
- ARGTNVGRECCLEYFKGAIPLRKLKTWYQTSEDCSRDAIVFVTVQGRAICSDPNNKRVKNAVKYLQSLERS
- Versandbedingungen:
- Blue Ice
- Lagerbedingungen:
- -20[o]C reconstituted. Avoid freeze/thaw cycles., 2-8[o]C reconstituted., -20[o]C/-70[o]C lyophilized. Avoid freeze/thaw cycles.
- Hersteller:
- ABclonal Technology
- Typ:
- Proteins, Peptides, Small Molecules & Other Biomolecules: Recombinant Proteins
- Datenblatt des Herstellers:RP01374