Recombinant Mouse IL-15RA/CD215 Protein
Produktgrößen
10 ug
£133,00
RP01373-10UG
20 ug
£181,00
RP01373-20UG
50 ug
£240,00
RP01373-50UG
100 ug
£353,00
RP01373-100UG
500 ug
£1002,00
RP01373-500UG
1000 ug
£1574,00
RP01373-1000UG
Über dieses Produkt
- SKU:
- RP01373
- Zusätzliche Namen:
- IL-15RA,CD215,AA690181,IL15RA
- Weitere Details:
- Mouse interleukin-15 receptor subunit alpha, also known as Il15ra, is a high-affinity receptor for interleukin-15.Il15ra associates as a heterotrimer with the IL-2 receptor beta and gamma subunits (Common gamma chain, orgamma c) to initiate signal transduction. It can signal both in cis and trans where IL15R from one subset of cellspresents IL15 to neighboring IL2RG-expressing cells. Il15ra is expressed in special cells including a wide varietyof Tand B cells and non-lymphoid cells. Human Il15ra shares 45% amino acid sequence homology with themouse form of the receptor. Eight isoforms of IL-15 R alpha mRNA have been identified, resulting fromalternative splicing events involving different exons.
- Formulierung:
- Recombinant Mouse IL-15RA/CD215 Protein is produced by HEK293 cells expression system. The target protein is expressed with sequence (Gly33-Lys205) of mouse IL15RA/CD215 (Accession #NP_032384.1) fused
- Immunogen:
- Gly33-Lys205
- Molekulargewicht:
- 70-90 kDa
- Physischer Zustand:
- Lyophilized
- Reinheit:
- ≥95%
- Sequenz:
- GTTCPPPVSIEHADIRVKNYSVNSRERYVCNSGFKRKAGTSTLIECVINKNTNVAHWTTPSLKCIRDPSLAHYSPVPTVVTPKVTSQPESPSPSAKEPEAFSPKSDTAMTTETAIMPGSRLTPSQTTSAGTTGTGSHKSSRAPSLAATMTLEPTASTSLRITEISPHSSKMTK
- Versandbedingungen:
- Blue Ice
- Lagerbedingungen:
- -20[o]C reconstituted. Avoid freeze/thaw cycles., 2-8[o]C reconstituted., -20[o]C/-70[o]C lyophilized. Avoid freeze/thaw cycles.
- Hersteller:
- ABclonal Technology
- Typ:
- Proteins, Peptides, Small Molecules & Other Biomolecules: Recombinant Proteins
- Datenblatt des Herstellers:RP01373
