Recombinant Human B7-H6/NCR3LG1 Protein
Produktgrößen
10 ug
£133,00
RP01356-10UG
20 ug
£181,00
RP01356-20UG
50 ug
£240,00
RP01356-50UG
100 ug
£353,00
RP01356-100UG
500 ug
£1002,00
RP01356-500UG
1000 ug
£1574,00
RP01356-1000UG
Über dieses Produkt
- SKU:
- RP01356
- Zusätzliche Namen:
- B7-H6,NCR3LG1,B7 Homolog 6,NCR3LG1
- Weitere Details:
- Natural cytotoxicity triggering receptor 3 ligand 1(B7-H6) is a glycosylated member of the B7 family of immune costimulatory proteins. Mature human B7-H6 consists of a 238 amino acid (aa) extracellular domain (ECD) that contains one Ig-like V domain and one Ig-like C1 domain, a 21 aa transmembrane segment, and a 171 aa cytoplasmic domain that contains one ITIM, one SH2, and one SH3 motif. Both of the Ig-like domains carry N-linked glycosylation. The Ig-like V domain mediates 1:1 stoichiometric binding of B7-H6 to NKp30 expressed on NK cells. It does not show binding to NKp44, NKp46, or NKG2D. Ligation of NKp30 by B7-H6 induces NK cell activation and target cell cytolysis. B7-H6 is expressed on a wide range of hematopoietic, carcinoma, and melanoma tumor cells, which is consistent with the detection of NKp30 binding sites on many tumors.
- Formulierung:
- Recombinant Human B7-H6/NCR3LG1 Protein is produced by HEK293 cells expression system. The target protein is expressed with sequence (Asp25-Ser262) of human B7-H6/NCR3LG1 (Accession #NP_001189368.1) f
- Immunogen:
- Asp25-Ser262
- Molekulargewicht:
- 40-60 kDa
- Physischer Zustand:
- Lyophilized
- Reinheit:
- ≥90%
- Sequenz:
- DLKVEMMAGGTQITPLNDNVTIFCNIFYSQPLNITSMGITWFWKSLTFDKEVKVFEFFGDHQEAFRPGAIVSPWRLKSGDASLRLPGIQLEEAGEYRCEVVVTPLKAQGTVQLEVVASPASRLLLDQVGMKENEDKYMCESSGFYPEAINITWEKQTQKFPHPIEISEDVITGPTIKNMDGTFNVTSCLKLNSSQEDPGTVYQCVVRHASLHTPLRSNFTLTAARHSLSETEKTDNFS
- Versandbedingungen:
- Blue Ice
- Lagerbedingungen:
- -20[o]C reconstituted. Avoid freeze/thaw cycles., 2-8[o]C reconstituted., -20[o]C/-70[o]C lyophilized. Avoid freeze/thaw cycles.
- Hersteller:
- ABclonal Technology
- Typ:
- Proteins, Peptides, Small Molecules & Other Biomolecules: Recombinant Proteins
- Datenblatt des Herstellers:RP01356