Recombinant Human Dkk-1 Protein
Produktgrößen
100 ug
£ POA
RP01343-100UG
50 ug
£ POA
RP01343-50UG
10 ug
£128,00
RP01343-10UG
20 ug
£158,00
RP01343-20UG
500 ug
£1478,00
RP01343-500UG
1000 ug
£2335,00
RP01343-1000UG
Über dieses Produkt
- SKU:
- RP01343
- Zusätzliche Namen:
- DKK1,DKK-1,SK
- Weitere Details:
- Members of the dickkopf-related protein family (DKK-1, -2, -3, and -4) are secreted proteins with two cysteine-rich domains separated by a linker region. And DKK1 takes part in embryonic development through its inhibition of the WNT signaling pathway, binds to LRP6 with high affinity and prevents the Frizzled-Wnt-LRP6 complex formation in response to Wnts. DKK1 promotes LRP6 internalization and degradation when it forms a ternary complex with the cell surface receptor Kremen.DKK1 not olny functions as a head inducer during development, but also regulates joint remodeling and bone formation, which suggests roles for DKK1 in the pathogenesis of rheumatoid arthritis and multiple myeloma. More recently research reported, DKK1 impacts eye development from a defined developmental time point on, and is critical for lens separation from the surface ectoderm via B Beta-catenin mediated PdgfrA Alpha and E-cadherin expression.
- Formulierung:
- Recombinant Human Dkk-1 Protein is produced by HEK293 cells expression system. The target protein is expressed with sequence (Thr32-His266) of human DKK-1 (Accession #NP_036374.1) fused with 6xHis tag
- Immunogen:
- Thr32-His266
- Molekulargewicht:
- 40-45 kDa
- Physischer Zustand:
- Lyophilized
- Reinheit:
- ≥95%
- Sequenz:
- TLNSVLNSNAIKNLPPPLGGAAGHPGSAVSAAPGILYPGGNKYQTIDNYQPYPCAEDEECGTDEYCASPTRGGDAGVQICLACRKRRKRCMRHAMCCPGNYCKNGICVSSDQNHFRGEIEETITESFGNDHSTLDGYSRRTTLSSKMYHTKGQEGSVCLRSSDCASGLCCARHFWSKICKPVLKEGQVCTKHRRKGSHGLEIFQRCYCGEGLSCRIQKDHHQASNSSRLHTCQRH
- Versandbedingungen:
- Blue Ice
- Lagerbedingungen:
- -20[o]C reconstituted. Avoid freeze/thaw cycles., 2-8[o]C reconstituted., -20[o]C/-70[o]C lyophilized. Avoid freeze/thaw cycles.
- Hersteller:
- ABclonal Technology
- Typ:
- Proteins, Peptides, Small Molecules & Other Biomolecules: Recombinant Proteins
- Datenblatt des Herstellers:RP01343