Recombinant SARS-CoV Spike RBD Protein
Produktgrößen
100 ug
£353,00
RP01299-100UG
500 ug
£1002,00
RP01299-500UG
1000 ug
£1574,00
RP01299-1000UG
Über dieses Produkt
- SKU:
- RP01299
- Zusätzliche Namen:
- Spike,Spike RBD,Spike S1
- Weitere Details:
- Recombinant SARS-CoV Spike RBD Protein is produced by HEK293 cells expression system. The target protein is expressed with sequence (Arg306-Phe527) of sars-cov Spike RBD (Accession #NP_828851.1) fused with a 6xHis tag at the C-terminus.
- Formulierung:
- Recombinant SARS-CoV Spike RBD Protein is produced by HEK293 cells expression system. The target protein is expressed with sequence (Arg306-Phe527) of sars-cov Spike RBD (Accession #NP_828851.1) fused
- Immunogen:
- Arg306-Phe527
- Molekulargewicht:
- 36-40
- Physischer Zustand:
- Lyophilized
- Reinheit:
- ≥95%
- Sequenz:
- RVVPSGDVVRFPNITNLCPFGEVFNATKFPSVYAWERKKISNCVADYSVLYNSTFFSTFKCYGVSATKLNDLCFSNVYADSFVVKGDDVRQIAPGQTGVIADYNYKLPDDFMGCVLAWNTRNIDATSTGNYNYKYRYLRHGKLRPFERDISNVPFSPDGKPCTPPALNCYWPLNDYGFYTTTGIGYQPYRVVVLSFELLNAPATVCGPKLSTDLIKNQCVNF
- Versandbedingungen:
- Blue Ice
- Lagerbedingungen:
- -20[o]C reconstituted. Avoid freeze/thaw cycles., 2-8[o]C reconstituted., -20[o]C/-70[o]C lyophilized. Avoid freeze/thaw cycles.
- Hersteller:
- ABclonal Technology
- Typ:
- Proteins, Peptides, Small Molecules & Other Biomolecules: Recombinant Proteins
- Datenblatt des Herstellers:RP01299
