Recombinant Human Noggin/NOG Protein
Produktgrößen
1000 ug
£ POA
RP01237-1000UG
10 ug
£145,00
RP01237-10UG
20 ug
£193,00
RP01237-20UG
50 ug
£288,00
RP01237-50UG
100 ug
£431,00
RP01237-100UG
500 ug
£1240,00
RP01237-500UG
Über dieses Produkt
- SKU:
- RP01237
- Zusätzliche Namen:
- NOG,SYM1,SYNS1,SYNS1A,noggin
- Weitere Details:
- By diffusing through extracellular matrices more efficiently than members of the TGF-beta superfamily, this protein may have a principal role in creating morphogenic gradients. The protein appears to have pleiotropic effect, both early in development as well as in later stages. It was originally isolated from Xenopus based on its ability to restore normal dorsal-ventral body axis in embryos that had been artificially ventralized by UV treatment. The results of the mouse knockout of the ortholog suggest that it is involved in numerous developmental processes, such as neural tube fusion and joint formation. Recently, several dominant human NOG mutations in unrelated families with proximal symphalangism (SYM1) and multiple synostoses syndrome (SYNS1) were identified; both SYM1 and SYNS1 have multiple joint fusion as their principal feature, and map to the same region (17q22) as this gene. All of these mutations altered evolutionarily conserved amino acid residues. The amino acid sequence of this human gene is highly homologous to that of Xenopus, rat and mouse.
- Formulierung:
- Recombinant Human Noggin/NOG Protein is produced by HEK293 cells expression system. The target protein is expressed with sequence (Gln28-Cys232) of human Noggin (Accession #NP_005441.1) fused with a 6
- Immunogen:
- Gln28-Cys232
- Molekulargewicht:
- 35-38 kDa
- Physischer Zustand:
- Lyophilized
- Reinheit:
- ≥95%
- Sequenz:
- QHYLHIRPAPSDNLPLVDLIEHPDPIFDPKEKDLNETLLRSLLGGHYDPGFMATSPPEDRPGGGGGAAGGAEDLAELDQLLRQRPSGAMPSEIKGLEFSEGLAQGKKQRLSKKLRRKLQMWLWSQTFCPVLYAWNDLGSRFWPRYVKVGSCFSKRSCSVPEGMVCKPSKSVHLTVLRWRCQRRGGQRCGWIPIQYPIISECKCSC
- Versandbedingungen:
- Blue Ice
- Lagerbedingungen:
- -20[o]C reconstituted. Avoid freeze/thaw cycles., 2-8[o]C reconstituted., -20[o]C/-70[o]C lyophilized. Avoid freeze/thaw cycles.
- Hersteller:
- ABclonal Technology
- Typ:
- Proteins, Peptides, Small Molecules & Other Biomolecules: Recombinant Proteins
- Datenblatt des Herstellers:RP01237