Recombinant Mouse B7-2/CD86 Protein
Produktgrößen
10 ug
£127,00
RP01235-10UG
20 ug
£157,00
RP01235-20UG
50 ug
£223,00
RP01235-50UG
100 ug
£336,00
RP01235-100UG
500 ug
£937,00
RP01235-500UG
1000 ug
£1478,00
RP01235-1000UG
Über dieses Produkt
- SKU:
- RP01235
- Zusätzliche Namen:
- CD86,B7-2,B70,CD28LG2,LAB72,MGC34413,CD86,CD86,B7-2,B70,CD28LG2,LAB72,MGC34413,CD86
- Weitere Details:
- CD86, also known as B-lymphocyte activation antigen B7-2 (referred to as B70), is a member of the cell surface immunoglobulin superfamily. CD86 is expressed by antigen-presenting cells, and it is the ligand for two proteins at the cell surface of T cells, CD28 antigen and cytotoxic T-lymphocyte-associated protein 4. Binding of this protein with CD28 antigen is a costimulatory signal for activation of the T-cell. Binding of this protein with cytotoxic T-lymphocyte-associated protein 4 negatively regulates T-cell activation and diminishes the immune response.
- Formulierung:
- Recombinant Mouse B7-2/CD86 Protein is produced by HEK293 cells expression system. The target protein is expressed with sequence (Val24-Glu245) of mouse CD86/B7-2 (Accession #NP_062261.3) fused with a
- Immunogen:
- Val24-Glu245
- Molekulargewicht:
- 65-90 kDa
- Physischer Zustand:
- Lyophilized
- Reinheit:
- ≥95%
- Sequenz:
- VSVETQAYFNGTAYLPCPFTKAQNISLSELVVFWQDQQKLVLYEHYLGTEKLDSVNAKYLGRTSFDRNNWTLRLHNVQIKDMGSYDCFIQKKPPTGSIILQQTLTELSVIANFSEPEIKLAQNVTGNSGINLTCTSKQGHPKPKKMYFLITNSTNEYGDNMQISQDNVTELFSISNSLSLSFPDGVWHMTVVCVLETESMKISSKPLNFTQEFPSPQTYWKE
- Versandbedingungen:
- Blue Ice
- Lagerbedingungen:
- -20[o]C reconstituted. Avoid freeze/thaw cycles., 2-8[o]C reconstituted., -20[o]C/-70[o]C lyophilized. Avoid freeze/thaw cycles.
- Hersteller:
- ABclonal Technology
- Typ:
- Proteins, Peptides, Small Molecules & Other Biomolecules: Recombinant Proteins
- Datenblatt des Herstellers:RP01235
