Recombinant Mouse IL-4 Protein
Produktgrößen
10 ug
£145,00
RP01161-10UG
20 ug
£193,00
RP01161-20UG
50 ug
£288,00
RP01161-50UG
100 ug
£431,00
RP01161-100UG
500 ug
£1240,00
RP01161-500UG
1000 ug
£1954,00
RP01161-1000UG
Über dieses Produkt
- SKU:
- RP01161
- Zusätzliche Namen:
- Il-4, BSF-1,IL4
- Weitere Details:
- Interleukin-4, also known as IL4, is a secreted protein that belongs to the IL-4 / IL-13 family. Interleukin-4 / IL4 has many biological roles, including the stimulation of activated B-cell and T-cell proliferation. It enhances both secretion and cell surface expression of IgE and IgG1. Interleukin-4 / IL4 also regulates the expression of the low-affinity Fc receptor for IgE (CD23) on both lymphocytes and monocytes. Interleukin-4 is essential for the switching of B cells to IgE antibody production and the maturation of T helper (Th) cells toward the Th2 phenotype.
- Formulierung:
- Recombinant Mouse IL-4 Protein is produced by HEK293 cells expression system. The target protein is expressed with sequence (His23-Ser140) of mouse IL-4 (Accession #NP_067258.1) fused with a 6xHis tag
- Immunogen:
- His23-Ser140
- Molekulargewicht:
- 20 kDa
- Physischer Zustand:
- Lyophilized
- Reinheit:
- ≥ 95 % as determined by SDS-PAGE;≥ 95 %
- Sequenz:
- HGCDKNHLREIIGILNEVTGEGTPCTEMDVPNVLTATKNTTESELVCRASKVLRIFYLKHGKTPCLKKNSSVLMELQRLFRAFRCLDSSISCTMNESKSTSLKDFLESLKSIMQMDYS
- Versandbedingungen:
- Blue Ice
- Lagerbedingungen:
- -20[o]C reconstituted. Avoid freeze/thaw cycles., 2-8[o]C reconstituted., -20[o]C/-70[o]C lyophilized. Avoid freeze/thaw cycles.
- Hersteller:
- ABclonal Technology
- Typ:
- Proteins, Peptides, Small Molecules & Other Biomolecules: Recombinant Proteins
- Datenblatt des Herstellers:RP01161