Recombinant Mouse TIM-3/HAVCR2/CD366 Protein
Produktgrößen
10 ug
£127,00
RP01153-10UG
20 ug
£157,00
RP01153-20UG
50 ug
£223,00
RP01153-50UG
100 ug
£336,00
RP01153-100UG
500 ug
£907,00
RP01153-500UG
1000 ug
£1478,00
RP01153-1000UG
Über dieses Produkt
- SKU:
- RP01153
- Zusätzliche Namen:
- Tim, TIM-, Tim3, Timd, TIM-3, Timd3,HAVCR2
- Weitere Details:
- HAVCR2 also known as TIM3(T cell immunoglobulin and mucin domain-3) is belongs to the immunoglobulin superfamily, and TIM family of proteins. CD4-positive T helper lymphocytes can be divided into types 1 (Th1) and 2 (Th2) on the basis of their cytokine secretion patterns. Th1 cells are involved in cell-mediated immunity to intracellular pathogens and delayed-type hypersensitivity reactions, whereas, Th2 cells are involved in the control of extracellular helminthic infections and the promotion of atopic and allergic diseases. This protein is a Th1-specific cell surface protein that regulates macrophage activation, and inhibits Th1-mediated auto- and alloimmune responses, and promotes immunological tolerance. Its binding to Galectin-9 induces a range of immunosuppressive functions which enhance immune tolerance and inhibit anti-tumor immunity .
- Formulierung:
- Recombinant Mouse TIM-3/HAVCR2/CD366 Protein is produced by HEK293 cells expression system. The target protein is expressed with sequence (Arg20-Arg191) of mouse TIM-3 (Accession #NP_599011.2) fused w
- Immunogen:
- Arg20-Arg191
- Molekulargewicht:
- 55-70 kDa
- Physischer Zustand:
- Lyophilized
- Reinheit:
- ≥95%
- Sequenz:
- RSLENAYVFEVGKNAYLPCSYTLSTPGALVPMCWGKGFCPWSQCTNELLRTDERNVTYQKSSRYQLKGDLNKGDVSLIIKNVTLDDHGTYCCRIQFPGLMNDKKLELKLDIKAAKVTPAQTAHGDSTTASPRTLTTERNGSETQTLVTLHNNNGTKISTWADEIKDSGETIR
- Versandbedingungen:
- Blue Ice
- Lagerbedingungen:
- -20[o]C reconstituted. Avoid freeze/thaw cycles., 2-8[o]C reconstituted., -20[o]C/-70[o]C lyophilized. Avoid freeze/thaw cycles.
- Hersteller:
- ABclonal Technology
- Typ:
- Proteins, Peptides, Small Molecules & Other Biomolecules: Recombinant Proteins
- Datenblatt des Herstellers:RP01153
