Recombinant Human IGFBP-8/CTGF Protein
Produktgrößen
10 ug
£145,00
RP01113-10UG
50 ug
£336,00
RP01113-50UG
500 ug
£2050,00
RP01113-500UG
1000 ug
£2430,00
RP01113-1000UG
Über dieses Produkt
- SKU:
- RP01113
- Zusätzliche Namen:
- CTGF,CCN2,HCS24,IGFBP8,NOV2
- Weitere Details:
- This protein is a mitogen that is secreted by vascular endothelial cells. The encoded protein plays a role in chondrocyte proliferation and differentiation, cell adhesion in many cell types, and is related to platelet-derived growth factor. Certain polymorphisms in this gene have been linked with a higher incidence of systemic sclerosis.
- Formulierung:
- Recombinant Human IGFBP-8/CTGF Protein is produced by Mammalian expression system. The target protein is expressed with sequence (Gln27-Ala180) of human CTGF (Accession #P29279) fused with no tags.
- Immunogen:
- Gln27-Ala180
- Molekulargewicht:
- 16-25 kDa
- Physischer Zustand:
- Lyophilized
- Reinheit:
- ≥95%
- Sequenz:
- QNCSGPCRCPDEPAPRCPAGVSLVLDGCGCCRVCAKQLGELCTERDPCDPHKGLFCDFGSPANRKIGVCTAKDGAPCIFGGTVYRSGESFQSSCKYQCTCLDGAVGCMPLCSMDVRLPSPDCPFPRRVKLPGKCCEEWVCDEPKDQTVVGPALA
- Versandbedingungen:
- Blue Ice
- Lagerbedingungen:
- -20[o]C reconstituted. Avoid freeze/thaw cycles., 2-8[o]C reconstituted., -20[o]C/-70[o]C lyophilized. Avoid freeze/thaw cycles.
- Hersteller:
- ABclonal Technology
- Typ:
- Proteins, Peptides, Small Molecules & Other Biomolecules: Recombinant Proteins
- Datenblatt des Herstellers:RP01113