Recombinant Human Serpin B3/SCCA-1 Protein
Produktgrößen
10 ug
£145,00
RP01110-10UG
20 ug
£193,00
RP01110-20UG
50 ug
£288,00
RP01110-50UG
100 ug
£431,00
RP01110-100UG
500 ug
£1240,00
RP01110-500UG
1000 ug
£1954,00
RP01110-1000UG
Über dieses Produkt
- SKU:
- RP01110
- Zusätzliche Namen:
- SERPINB3, HsT1196, SCC, SCCA-1, SCCA-PD, SCCA1, SSCA1, T4-A, serpin B3,SerpinB3,HsT1196,SCC,SCCA-1,SCCA-PD,SCCA1,SSCA1,T4-A,serpin B3
- Weitere Details:
- Serpin B3, also known as squamous cell carcinoma antigen-1 (SCCA-1), is a member of the serpin superfamily of serine protease inhibitors. Serpin B3 belongs to the subgroup ovalbumin-related serpins which are involved in the regulation of apoptosis, inflammation, angiogenesis and embryogenesis. It may act as a papain-like cysteine protease inhibitor to modulate the host immune response against tumor cells. It also functions as an inhibitor of UV-induced apoptosis via suppression of the activity of c-Jun NH(2)-terminal kinase (JNK1).
- Formulierung:
- Recombinant Human Serpin B3/SCCA-1 Protein is produced by Mammalian expression system. The target protein is expressed with sequence (Met1-Pro390) of human Serpin B3 (Accession #P29508) fused with a 6
- Immunogen:
- Met1-Pro390
- Molekulargewicht:
- 50-65 kDa
- Physischer Zustand:
- Lyophilized
- Reinheit:
- ≥95%
- Sequenz:
- MNSLSEANTKFMFDLFQQFRKSKENNIFYSPISITSALGMVLLGAKDNTAQQIKKVLHFDQVTENTTGKAATYHVDRSGNVHHQFQKLLTEFNKSTDAYELKIANKLFGEKTYLFLQEYLDAIKKFYQTSVESVDFANAPEESRKKINSWVESQTNEKIKNLIPEGNIGSNTTLVLVNAIYFKGQWEKKFNKEDTKEEKFWPNKNTYKSIQMMRQYTSFHFASLEDVQAKVLEIPYKGKDLSMIVLLPNEIDGLQKLEEKLTAEKLMEWTSLQNMRETRVDLHLPRFKVEESYDLKDTLRTMGMVDIFNGDADLSGMTGSRGLVLSGVLHKAFVEVTEEGAEAAAATAVVGFGSSPTSTNEEFHCNHPFLFFIRQNKTNSILFYGRFSSP
- Versandbedingungen:
- Blue Ice
- Lagerbedingungen:
- -20[o]C reconstituted. Avoid freeze/thaw cycles., 2-8[o]C reconstituted., -20[o]C/-70[o]C lyophilized. Avoid freeze/thaw cycles.
- Hersteller:
- ABclonal Technology
- Typ:
- Proteins, Peptides, Small Molecules & Other Biomolecules: Recombinant Proteins
- Datenblatt des Herstellers:RP01110