Recombinant Human Activin RIIA/ACVR2A Protein
Produktgrößen
10 ug
£145,00
RP01094-10UG
50 ug
£336,00
RP01094-50UG
500 ug
£2050,00
RP01094-500UG
1000 ug
£2430,00
RP01094-1000UG
Über dieses Produkt
- SKU:
- RP01094
- Zusätzliche Namen:
- ACTRII, ACVR2,ACVR2A,ACVR2
- Weitere Details:
- This protein is a receptor that mediates the functions of activins, which are members of the transforming growth factor-beta (TGF-beta) superfamily involved in diverse biological processes. The encoded protein is a transmembrane serine-threonine kinase receptor which mediates signaling by forming heterodimeric complexes with various combinations of type I and type II receptors and ligands in a cell-specific manner. The encoded type II receptor is primarily involved in ligand-binding and includes an extracellular ligand-binding domain, a transmembrane domain and a cytoplasmic serine-threonine kinase domain. This gene may be associated with susceptibility to preeclampsia, a pregnancy-related disease which can result in maternal and fetal morbidity and mortality. Alternative splicing results in multiple transcript variants of this gene.
- Formulierung:
- Recombinant Human Activin RIIA/ACVR2A Protein is produced by Mammalian expression system. The target protein is expressed with sequence (Ala20-Pro134) of human ACVR2A (Accession #P27037) fused with a
- Immunogen:
- Ala20-Pro134
- Molekulargewicht:
- 28-38 kDa
- Physischer Zustand:
- Lyophilized
- Reinheit:
- ≥95%
- Sequenz:
- AILGRSETQECLFFNANWEKDRTNQTGVEPCYGDKDKRRHCFATWKNISGSIEIVKQGCWLDDINCYDRTDCVEKKDSPEVYFCCCEGNMCNEKFSYFPEMEVTQPTSNPVTPKP
- Versandbedingungen:
- Blue Ice
- Lagerbedingungen:
- -20[o]C reconstituted. Avoid freeze/thaw cycles., 2-8[o]C reconstituted., -20[o]C/-70[o]C lyophilized. Avoid freeze/thaw cycles.
- Hersteller:
- ABclonal Technology
- Typ:
- Proteins, Peptides, Small Molecules & Other Biomolecules: Enzymes
- Datenblatt des Herstellers:RP01094