Recombinant Mouse IL-21R/CD360 Protein
Produktgrößen
10 ug
£133,00
RP01079-10UG
20 ug
£181,00
RP01079-20UG
50 ug
£240,00
RP01079-50UG
100 ug
£353,00
RP01079-100UG
500 ug
£1002,00
RP01079-500UG
1000 ug
£1574,00
RP01079-1000UG
Über dieses Produkt
- SKU:
- RP01079
- Zusätzliche Namen:
- CD360,NILR,IL-21 R,IL-21 receptor,IL21R,IL-21R,interleukin 21 receptor,interleukin-21 receptor, IL21R
- Weitere Details:
- Interleukin-21 receptor, also known as IL-21 receptor, IL-21R, Novel interleukin receptor, IL21R and NILR, is a single-pass type I membrane protein which belongs to the type I cytokine receptor family and Type 4 subfamily. Interleukin-21 (IL-21) belongs to a family of cytokines,and has been shown to form a heterodimeric receptor complex with the common gamma-chain, a receptor subunit also shared by the receptors for interleukin 2, 4, 7, 9, and 15. This receptor transduces the growth promoting signal of IL21, and is important for the proliferation and differentiation of T cells, B cells, and natural killer (NK) cells. The ligand binding of this receptor leads to the activation of multiple downstream signaling molecules, including JAK1, JAK3, STAT1, and STAT3.
- Formulierung:
- Recombinant Mouse IL-21R/CD360 Protein is produced by HEK293 cells expression system. The target protein is expressed with sequence (Cys20-Pro236) of mouse IL-21R/Interleukin-21 Receptor (Accession #N
- Immunogen:
- Cys20-Pro236
- Molekulargewicht:
- 40-55 kDa
- Physischer Zustand:
- Lyophilized
- Reinheit:
- ≥ 95 % as determined by SDS-PAGE;≥ 90 %
- Sequenz:
- CLDLTCYTDYLWTITCVLETRSPNPSILSLTWQDEYEELQDQETFCSLHRSGHNTTHIWYTCHMRLSQFLSDEVFIVNVTDQSGNNSQECGSFVLAESIKPAPPLNVTVAFSGRYDISWDSAYDEPSNYVLRGKLQYELQYRNLRDPYAVRPVTKLISVDSRNVSLLPEEFHKDSSYQLQVRAAPQPGTSFRGTWSEWSDPVIFQTQAGEPEAGWDP
- Versandbedingungen:
- Blue Ice
- Lagerbedingungen:
- -20[o]C reconstituted. Avoid freeze/thaw cycles., 2-8[o]C reconstituted., -20[o]C/-70[o]C lyophilized. Avoid freeze/thaw cycles.
- Hersteller:
- ABclonal Technology
- Typ:
- Proteins, Peptides, Small Molecules & Other Biomolecules: Recombinant Proteins
- Datenblatt des Herstellers:RP01079

